Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.46
PubTator Score 16.91

Knowledge Summary

Patent (20,135)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung cancer 4473 3.22173177251051E-5
ovarian cancer 8492 0.00722907280848181
osteosarcoma 7933 0.00781154473353272
ependymoma 2514 0.0303391996431517
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0308725472050287
Multiple myeloma 1328 0.0449629143629525
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
adult-onset Still's disease 6 3.594 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.578 0.045
ependymoma 1.100 0.030
osteosarcoma 1.115 0.008
intraductal papillary-mucinous neoplasm ... 1.700 0.031
lung cancer 1.700 0.000
ovarian cancer 1.600 0.007

Synonym

Accession Q8IVH8 Q6IQ39 Q8IVH7 Q9UDM5 Q9Y6R5
Symbols GLK
MEKKK3
MEKKK 3
MAPKKKK3
RAB8IPL1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (10)

PMID Text
23981581 ITGB3 and MAP4K3 are directly repressed by let-7c, altering the metastatic potential of lung cancer cells.
22898570 MAP4K3 expression is required for leucine-induced mTORC1 activation in human primary fibroblasts.
22867055 Significantly higher median frequencies of circulating GLK-expressing T-cells were observed in patients with adult-onset Still's disease (31.85%) than in healthy volunteers (8.93%, P <0.001).
21983831 enhanced expression in systemic lupus erythematosus
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20227368 Amino acid sufficiency phosphorylates MAP4K3/Ser170, activating mTORC1, but amino acid restriction causes MAP4K3 to interact with PP2A(T61 epsilon), promoting dephosphorylation of Ser170, MAP4K3 inhibition, and, inhibition of mTORC1 signaling.
20200978 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19587239 MAP4K3 orchestrates activation of BAX via the concerted posttranscriptional modulation of PUMA, BAD, and BIM.

AA Sequence

MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKH      1 - 70
PNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGA     71 - 140
NILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITAIELAEL    141 - 210
QPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQHLTRS    211 - 280
LAIELLDKVNNPDHSTYHDFDDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHH    281 - 350
ELPDSDGFLDSSEEIYYTARSNLDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDD    351 - 420
ESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVA    421 - 490
LGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIH    491 - 560
CASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKASQLYSHNLP    561 - 630
GLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLE    631 - 700
WVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESD    701 - 770
TPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQG    771 - 840
RSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY                    841 - 894
//

Text Mined References (25)

PMID Year Title
23981581 2014 MicroRNA let-7c inhibits migration and invasion of human non-small cell lung cancer by targeting ITGB3 and MAP4K3.
22898570 2013 Cellular signaling of amino acids towards mTORC1 activation in impaired human leucine catabolism.
22867055 2012 Germinal center kinase-like kinase (GLK/MAP4K3) expression is increased in adult-onset Still's disease and may act as an activity marker.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21983831 2011 The kinase GLK controls autoimmunity and NF-?B signaling by activating the kinase PKC-? in T cells.
20936779 2010 A human MAP kinase interactome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20227368 2010 PP2A T61 epsilon is an inhibitor of MAP4K3 in nutrient signaling to mTOR.
More...