Property Summary

Ligand Count 6
NCBI Gene PubMed Count 23
PubMed Score 15.30
PubTator Score 16.91

Knowledge Summary

Patent (20,135)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.100 3.0e-02
intraductal papillary-mucinous neoplasm ... 1.700 3.1e-02
lung cancer 1.700 3.2e-05
Multiple myeloma 1.578 4.5e-02
osteosarcoma 1.115 7.8e-03
ovarian cancer -1.200 8.5e-03

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKH      1 - 70
PNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGA     71 - 140
NILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITAIELAEL    141 - 210
QPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQHLTRS    211 - 280
LAIELLDKVNNPDHSTYHDFDDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHH    281 - 350
ELPDSDGFLDSSEEIYYTARSNLDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDD    351 - 420
ESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVA    421 - 490
LGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIH    491 - 560
CASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKASQLYSHNLP    561 - 630
GLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLE    631 - 700
WVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESD    701 - 770
TPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQG    771 - 840
RSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY                    841 - 894
//

Text Mined References (28)

PMID Year Title