Property Summary

NCBI Gene PubMed Count 24
Grant Count 16
R01 Count 14
Funding $974,683.39
PubMed Score 12.73
PubTator Score 10.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.300 0.000
lung carcinoma 1.800 0.000

Gene RIF (14)

PMID Text
26642711 rs4714476 at the 5' near gene of FOXP4 potentially contributes to the susceptibility of prostate cancer in Chinese men
26537068 association of the THADA, FOXP4, GPRC6A/RFX6 and 8q24 genes with prostate cancer in Asian populations.
26484395 FOXP4 and SHROOM1 genes are hypermethylated in the knee osteoarthritic cartilage.
25994569 High FOXP4 expression is associated with non-small cell lung cancer.
25755720 These findings suggest that miR-338-3p regulates survival of hepatocellular carcinoma cells partially through the downregulation of FOXP4
25472883 HIV-1 Tat specifically associates with FOXP4 promoter to upregulate FOXP4 expression in T cells
22912696 Foxp4 is dispensable for T cell development, but necessary for normal T cell cytokine recall responses to antigen following pathogenic infection
22662242 Our results provide further support for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in Eastern Asian populations
20676098 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQAL      1 - 70
QVARQFLLQQASGLSSPGNNDSKQSASAVQVPVSVAMMSPQMLTPQQMQQILSPPQLQALLQQQQALMLQ     71 - 140
QLQEYYKKQQEQLHLQLLTQQQAGKPQPKEALGNKQLAFQQQLLQMQQLQQQHLLNLQRQGLVSLQPNQA    141 - 210
SGPLQTLPQAAVCPTDLPQLWKGEGAPGQPAEDSVKQEGLDLTGTAATATSFAAPPKVSPPLSHHTLPNG    211 - 280
QPTVLTSRRDSSSHEETPGSHPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQ    281 - 350
QLEIQLAKESERLQAMMAHLHMRPSEPKPFSQPLNPVPGSSSFSKVTVSAADSFPDGLVHPPTSAAAPVT    351 - 420
PLRPPGLGSASLHGGGPARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTL    421 - 490
NEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMTGSPTLVKN    491 - 560
MISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQ    561 - 630
YSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS                        631 - 680
//

Text Mined References (32)

PMID Year Title
26642711 2015 Association of FOXP4 Gene with Prostate Cancer and the Cumulative Effects of rs4714476 and 8q24 in Chinese Men.
26537068 Association of THADA, FOXP4, GPRC6A/RFX6 genes and 8q24 risk alleles with prostate cancer in Northern Chinese men.
26484395 2016 Identification of differentially methylated regions in new genes associated with knee osteoarthritis.
25994569 2015 FOXP4 modulates tumor growth and independently associates with miR-138 in non-small cell lung cancer cells.
25755720 2015 MicroRNA-338-3p inhibits cell proliferation in hepatocellular carcinoma by target forkhead box P4 (FOXP4).
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25027557 2015 Transcriptional regulation by FOXP1, FOXP2, and FOXP4 dimerization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22912696 2012 Foxp4 is dispensable for T cell development, but required for robust recall responses.
More...