Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.42
PubTator Score 9.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 5.7e-04
ependymoma 1.400 1.1e-05
gastric carcinoma 1.300 2.0e-02
glioblastoma 1.500 2.0e-04
group 3 medulloblastoma 1.200 1.2e-02
interstitial cystitis 1.200 2.4e-03
lung carcinoma -1.200 3.5e-13
osteosarcoma -1.561 6.1e-04
pediatric high grade glioma 1.100 4.3e-04
primitive neuroectodermal tumor 1.500 3.5e-02
subependymal giant cell astrocytoma 1.470 4.7e-02

Gene RIF (9)

AA Sequence

MGNLESAEGVPGEPPSVPLLLPPGKMPMPEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQ      1 - 70
ERFQVKNPPHTYIQKLQSFLDPSVTRKKFRRRVQESTKVLRELEISLRTNHIGWVREFLNDENKGLDVLV     71 - 140
DYLSFAQCSVMFDFEGLESGDDGAFDKLRSWSRSIEDLQPPSALSAPFTNSLARSARQSVLRYSTLPGRR    141 - 210
ALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVR    211 - 280
GGHEIILAAFDNFKEVCKELHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKL    281 - 350
GLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEKLLDLENENM    351 - 420
MRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVG    421 - 490
PAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR    491 - 560
IKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILEDLDLDKFEELFKTKAQGPALDLICSKNKTAQ    561 - 630
KAASKVTLLEANRAKNLAITLRKAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYERE    631 - 700
RQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEII    701 - 770
LALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVS    771 - 840
LENVLLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTP    841 - 910
PSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAK    911 - 980
EHRPVYEGKDGTIEDIITVLKSVPFTARTAKRGSRFFCDAAHHDESNC                          981 - 1028
//

Text Mined References (21)

PMID Year Title