Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.12
PubTator Score 9.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.47595720018064E-13
ependymoma 2514 1.4955138254203E-6
pilocytic astrocytoma 3086 6.64154847549773E-6
medulloblastoma 1524 3.67798797744859E-5
glioblastoma 5572 1.18913092026174E-4
pediatric high grade glioma 2712 4.26814044081782E-4
osteosarcoma 7933 6.08129896169279E-4
interstitial cystitis 2299 0.00237814428116299
gastric carcinoma 832 0.0196056374062868
primitive neuroectodermal tumor 3031 0.0354557287103033
subependymal giant cell astrocytoma 2287 0.0472750637436515
Disease Target Count Z-score Confidence
Chondrosarcoma 24 3.413 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.561 0.001
ependymoma 1.700 0.000
medulloblastoma 1.800 0.000
glioblastoma 1.600 0.000
primitive neuroectodermal tumor 1.500 0.035
interstitial cystitis 1.200 0.002
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.400 0.000
subependymal giant cell astrocytoma 1.470 0.047
lung carcinoma -1.200 0.000
gastric carcinoma 1.300 0.020

Synonym

Accession Q8IVF7 B0JZA7 Q6ZRJ1
Symbols FRL2
WBP3
FHOD3
WBP-3

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (8)

PMID Text
26446836 we use a simple cellular system to examine fundamental features of formin-mediated filopodial assembly, using constitutively active constructs of the formins mDia2 and FMNL3
26299518 FMNL3 interacts with Cdc42 and RhoJ, two Rho family GTPases known to be required for lumen formation. FMNL3 and RhoJ are concentrated at the early apical surface, or AMIS, and regulate the formation of radiating actin cables from this site.
25758200 FMNL3 plays an important role in the progression and metastasis of colorectal carcinoma and may be a novel potential prognostic predictor in colorectal carcinoma.
25428984 FMNL3 functions in assembly of actin-based protrusions that are specialized for cell-cell adhesion.
24223803 miR-335 regulates the expression of at least five formin family members, three of which are validated, FMNL3, FMN2 and DAAM2.
22790947 Protein N-myristoylation plays critical roles in the cellular morphological changes induced by FMNL2 and FMNL3.
22275430 Formin-like 3 (FMNL3) is a crucial regulator of endothelial cell elongation during angiogenesis.
20862687 Data suggest that the FH2 domain of FRL2 possesses properties not shared by FRL1 that allow it to generate filopodia.

AA Sequence

MGNLESAEGVPGEPPSVPLLLPPGKMPMPEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQ      1 - 70
ERFQVKNPPHTYIQKLQSFLDPSVTRKKFRRRVQESTKVLRELEISLRTNHIGWVREFLNDENKGLDVLV     71 - 140
DYLSFAQCSVMFDFEGLESGDDGAFDKLRSWSRSIEDLQPPSALSAPFTNSLARSARQSVLRYSTLPGRR    141 - 210
ALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVR    211 - 280
GGHEIILAAFDNFKEVCKELHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKL    281 - 350
GLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEKLLDLENENM    351 - 420
MRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVG    421 - 490
PAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR    491 - 560
IKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILEDLDLDKFEELFKTKAQGPALDLICSKNKTAQ    561 - 630
KAASKVTLLEANRAKNLAITLRKAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYERE    631 - 700
RQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEII    701 - 770
LALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVS    771 - 840
LENVLLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTP    841 - 910
PSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAK    911 - 980
EHRPVYEGKDGTIEDIITVLKSVPFTARTAKRGSRFFCDAAHHDESNC                          981 - 1028
//

Text Mined References (20)

PMID Year Title
26446836 2015 Cell type-dependent mechanisms for formin-mediated assembly of filopodia.
26299518 2015 The Formin FMNL3 Controls Early Apical Specification in Endothelial Cells by Regulating the Polarized Trafficking of Podocalyxin.
25758200 2015 Increased expression of formin-like 3 contributes to metastasis and poor prognosis in colorectal carcinoma.
25428984 2015 The formin FMNL3 assembles plasma membrane protrusions that participate in cell-cell adhesion.
24223803 2013 Metastasis suppressor microRNA-335 targets the formin family of actin nucleators.
22790947 2012 Protein N-myristoylation is required for cellular morphological changes induced by two formin family proteins, FMNL2 and FMNL3.
22275430 2012 The formin FMNL3 is a cytoskeletal regulator of angiogenesis.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21148482 2011 Bi-modal regulation of a formin by srGAP2.
20862687 2010 Assembly of filopodia by the formin FRL2 (FMNL3).
More...