Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
Funding $363,737.5
PubMed Score 14.70
PubTator Score 20.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 0.032
posterior fossa group B ependymoma -2.800 0.000
oligodendroglioma -2.000 0.012
glioblastoma -2.000 0.000
group 4 medulloblastoma -3.000 0.000
atypical teratoid / rhabdoid tumor -1.800 0.005
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.700 0.013
tuberculosis -1.400 0.000
adult high grade glioma -1.500 0.007
subependymal giant cell astrocytoma -1.780 0.040
psoriasis -1.800 0.000
ovarian cancer -1.900 0.000

Gene RIF (6)

PMID Text
24377522 Knockdown of TIAM2 could up-regulate the expression of E-cadherin.
21469146 TIAM2 expression was undetectable in normal human liver but was induced in all HCC cell lines and in 86% (78/91) of HCC biopsies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of T-cell lymphoma invasion and metastasis 2 (TIAM2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
11900975 stef gene expressed in a stage- and region-specific manner in the mouse brain
10364228 STEF protein is a guanine nucleotide exchange factor that specifically activates Rac1 in vitro and in cultured cells, which may lead to changes in the actin cytoskeletal network.

AA Sequence

MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHAKEEKSLHGWGHGSNGAGYKSRSLARSCLSHFKS      1 - 70
NQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGISAAFSTENGFHSVGHELADNHITSRDCNGHLLNC     71 - 140
YGRNESIASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNGGNPSKVPAEDCSEPVQLLRYSPTLASETSP    141 - 210
VPEARRGSSADSLPSHRPSPTDSRLRSSKGSSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHAS    211 - 280
FPPGDAKKPFNQSSSLSSLRELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHGDP    281 - 350
IQYSSFTLPCRKPKAFVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV    351 - 420
QGSSQASAFLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETSTETAESSSESL    421 - 490
SSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWVTLKGCTLLFYETYGKNSMDQ    491 - 560
SSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQATSQTDLENWVTAVHSACASLFAKKHGKE    561 - 630
DTLRLLKNQTKNLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLAS    631 - 700
LQGGELPNPKSLLAAASRPSKLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKG    701 - 770
LDTLARKGKEKRPSITQVDELLHIYGSTVDGVPRDNAWEIQTYVHFQDNHGVTVGIKPEHRVEDILTLAC    771 - 840
KMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQQQVYDEIEVFPLNVYDVQLTKTGSVCDFGFAVTAQV    841 - 910
DERQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEALFSEKSVGLTLIARPPDTKAT    911 - 980
LCTSWSDSDLFSRDQKSLLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKRSQTDGTLDQVSHREK    981 - 1050
MEQTFRSAEQITALCRSFNDSQANGMEGPRENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVKDLSC   1051 - 1120
LFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGS   1121 - 1190
FLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLK   1191 - 1260
ELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTELSMGELLMHS   1261 - 1330
TVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHNSTDLDPFKFRWLIPISAL   1331 - 1400
QVRLGNPAGTENNSIWELIHTKSEIEGRPETIFQLCCSDSESKTNIVKVIRSILRENFRRHIKCELPLEK   1401 - 1470
TCKDRLVPLKNRVPVSAKLASSRSLKVLKNSSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQD   1471 - 1540
SKSTSPGKYPHPGLADFADNLIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQ   1541 - 1610
PGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLEREFSV   1611 - 1680
QSLTSVVSEECFYETESHGKS                                                    1681 - 1701
//

Text Mined References (16)

PMID Year Title
24377522 2013 TIAM2 enhances non-small cell lung cancer cell invasion and motility.
21469146 2012 Expression of T-cell lymphoma invasion and metastasis 2 (TIAM2) promotes proliferation and invasion of liver cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
More...