Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.70
PubTator Score 20.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
psoriasis 6685 3.41278482207517E-14
posterior fossa group B ependymoma 1530 2.20972843891769E-13
ovarian cancer 8492 5.74314460964029E-8
group 4 medulloblastoma 1875 3.8879391625935E-6
medulloblastoma, large-cell 6234 9.52253804206615E-5
glioblastoma 5572 9.6307587108011E-5
tuberculosis 1563 2.59383912678396E-4
atypical teratoid / rhabdoid tumor 4369 0.00509637159887941
adult high grade glioma 2148 0.00655086022216756
oligodendroglioma 2849 0.0117404274458321
primitive neuroectodermal tumor 3031 0.0125648951020777
astrocytic glioma 2241 0.0323333364442956
subependymal giant cell astrocytoma 2287 0.0404670054371071
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 0.032
posterior fossa group B ependymoma -2.800 0.000
oligodendroglioma -2.000 0.012
glioblastoma -2.000 0.000
group 4 medulloblastoma -3.000 0.000
atypical teratoid / rhabdoid tumor -1.800 0.005
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.700 0.013
tuberculosis -1.400 0.000
adult high grade glioma -1.500 0.007
subependymal giant cell astrocytoma -1.780 0.040
psoriasis -1.800 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q8IVF5 B2RP56 C9JZV2 Q6NXN9 Q6ZUP9 Q9UFG6 Q9UKV9 Q9UKW0 TIAM-2
Symbols STEF
TIAM-2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (6)

PMID Text
24377522 Knockdown of TIAM2 could up-regulate the expression of E-cadherin.
21469146 TIAM2 expression was undetectable in normal human liver but was induced in all HCC cell lines and in 86% (78/91) of HCC biopsies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of T-cell lymphoma invasion and metastasis 2 (TIAM2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
11900975 stef gene expressed in a stage- and region-specific manner in the mouse brain
10364228 STEF protein is a guanine nucleotide exchange factor that specifically activates Rac1 in vitro and in cultured cells, which may lead to changes in the actin cytoskeletal network.

AA Sequence

MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHAKEEKSLHGWGHGSNGAGYKSRSLARSCLSHFKS      1 - 70
NQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGISAAFSTENGFHSVGHELADNHITSRDCNGHLLNC     71 - 140
YGRNESIASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNGGNPSKVPAEDCSEPVQLLRYSPTLASETSP    141 - 210
VPEARRGSSADSLPSHRPSPTDSRLRSSKGSSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHAS    211 - 280
FPPGDAKKPFNQSSSLSSLRELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHGDP    281 - 350
IQYSSFTLPCRKPKAFVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV    351 - 420
QGSSQASAFLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETSTETAESSSESL    421 - 490
SSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWVTLKGCTLLFYETYGKNSMDQ    491 - 560
SSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQATSQTDLENWVTAVHSACASLFAKKHGKE    561 - 630
DTLRLLKNQTKNLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLAS    631 - 700
LQGGELPNPKSLLAAASRPSKLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKG    701 - 770
LDTLARKGKEKRPSITQVDELLHIYGSTVDGVPRDNAWEIQTYVHFQDNHGVTVGIKPEHRVEDILTLAC    771 - 840
KMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQQQVYDEIEVFPLNVYDVQLTKTGSVCDFGFAVTAQV    841 - 910
DERQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEALFSEKSVGLTLIARPPDTKAT    911 - 980
LCTSWSDSDLFSRDQKSLLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKRSQTDGTLDQVSHREK    981 - 1050
MEQTFRSAEQITALCRSFNDSQANGMEGPRENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVKDLSC   1051 - 1120
LFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGS   1121 - 1190
FLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLK   1191 - 1260
ELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTELSMGELLMHS   1261 - 1330
TVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHNSTDLDPFKFRWLIPISAL   1331 - 1400
QVRLGNPAGTENNSIWELIHTKSEIEGRPETIFQLCCSDSESKTNIVKVIRSILRENFRRHIKCELPLEK   1401 - 1470
TCKDRLVPLKNRVPVSAKLASSRSLKVLKNSSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQD   1471 - 1540
SKSTSPGKYPHPGLADFADNLIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQ   1541 - 1610
PGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLEREFSV   1611 - 1680
QSLTSVVSEECFYETESHGKS                                                    1681 - 1701
//

Text Mined References (16)

PMID Year Title
24377522 2013 TIAM2 enhances non-small cell lung cancer cell invasion and motility.
21469146 2012 Expression of T-cell lymphoma invasion and metastasis 2 (TIAM2) promotes proliferation and invasion of liver cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
More...