Property Summary

NCBI Gene PubMed Count 1
PubMed Score 3.19
PubTator Score 2.91

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count Z-score Confidence
Endometrial stromal nodule 8 4.382 2.2
Sarcoma 49 3.674 1.8
Disease Target Count
Endometrial stromal sarcoma 16


AA Sequence

RVSGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQRCSQ                                    841 - 878

Text Mined References (2)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.