Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.49
PubTator Score 4.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.1e-08
ependymoma -1.200 1.7e-13
glioblastoma -1.100 2.3e-05
medulloblastoma -1.100 9.4e-08
medulloblastoma, large-cell -1.500 1.6e-05
osteosarcoma -1.379 8.8e-05
primitive neuroectodermal tumor -1.100 4.4e-05

Gene RIF (3)

AA Sequence

METGAAELYDQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLRHPSDRMGFPPGAAQALVLQVFKTFD      1 - 70
HMARQDDEKRRQELEEKIRRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVK     71 - 140
EMAHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVV    141 - 210
KGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSLEPGKCVLVNLSKVGEYWWNAILEGE    211 - 280
EPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQRFDPA    281 - 350
MFNISPGAVQF                                                               351 - 361
//

Text Mined References (21)

PMID Year Title