Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.45
PubTator Score 4.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Liver neoplasms 109
Disease Target Count P-value
ependymoma 2514 1.67515757580156E-13
atypical teratoid / rhabdoid tumor 4369 1.0759744108387E-8
medulloblastoma 1524 9.36365906929057E-8
medulloblastoma, large-cell 6234 1.57001020121321E-5
glioblastoma 5572 2.27837116805347E-5
primitive neuroectodermal tumor 3031 4.39488233083423E-5
osteosarcoma 7933 8.8435891916861E-5

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.379 0.000
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.100 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.000

Synonym

Accession Q8IVD9 Q9BTI3 Q9H7W9 Q9UPT4
Symbols NudCL

Gene

PDB

1WGV  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19806165 overexpression of NudCL inhibits cytokinesis
16754861 Data characterize a previously undescribed mammalian NudC-like protein (NudCL), which appears to influence the stabilization of dynein intermediate chain

AA Sequence

METGAAELYDQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLRHPSDRMGFPPGAAQALVLQVFKTFD      1 - 70
HMARQDDEKRRQELEEKIRRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVK     71 - 140
EMAHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVV    141 - 210
KGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSLEPGKCVLVNLSKVGEYWWNAILEGE    211 - 280
EPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQRFDPA    281 - 350
MFNISPGAVQF                                                               351 - 361
//

Text Mined References (20)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19806165 2009 Inhibition of cytokinesis by overexpression of NudCL that is localized to the centrosome and midbody.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16754861 2006 A mammalian NudC-like protein essential for dynein stability and cell viability.
More...