Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
Funding $41,763
PubMed Score 0.62
PubTator Score 0.18

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
26310847 LIX1L is an RNA-binding protein, with implications for therapeutic approaches for targeting LIX1L in LIX1L-expressing cancer cells.

AA Sequence

METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGA      1 - 70
AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYVCYV     71 - 140
TLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHPSRRITDEFIEKSVSEALASFNGNREEADNPNT    141 - 210
GIGAFRFMLESNKGKSMLEFQELMTVFQLLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDW    211 - 280
VSREQSVPGALSRELASTERELDEARLAGKELRFHKEKKDILVLAAGQLGNMHSSNC                 281 - 337
//

Text Mined References (5)

PMID Year Title
26310847 2015 Novel roles for LIX1L in promoting cancer cell proliferation through ROS1-mediated LIX1L phosphorylation.
19710173 2009 Drosophila lowfat, a novel modulator of Fat signaling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.