Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.62
PubTator Score 0.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (1)

AA Sequence

METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGA      1 - 70
AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYVCYV     71 - 140
TLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHPSRRITDEFIEKSVSEALASFNGNREEADNPNT    141 - 210
GIGAFRFMLESNKGKSMLEFQELMTVFQLLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDW    211 - 280
VSREQSVPGALSRELASTERELDEARLAGKELRFHKEKKDILVLAAGQLGNMHSSNC                 281 - 337
//

Text Mined References (5)

PMID Year Title