Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.62
PubTator Score 0.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q8IVB5 Q6AI36
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

AA Sequence

METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGA      1 - 70
AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYVCYV     71 - 140
TLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHPSRRITDEFIEKSVSEALASFNGNREEADNPNT    141 - 210
GIGAFRFMLESNKGKSMLEFQELMTVFQLLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDW    211 - 280
VSREQSVPGALSRELASTERELDEARLAGKELRFHKEKKDILVLAAGQLGNMHSSNC                 281 - 337
//

Text Mined References (5)

PMID Year Title