Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.62
PubTator Score 0.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 4.19920755669055E-14
pilocytic astrocytoma 3086 8.83133826472904E-9
medulloblastoma, large-cell 6234 2.01456802513343E-6
osteosarcoma 7933 2.85371108977551E-6
breast carcinoma 1614 3.9398036460437E-5
group 4 medulloblastoma 1875 4.60868837004915E-5
primitive neuroectodermal tumor 3031 7.56903147622023E-5
atypical teratoid / rhabdoid tumor 4369 1.11528962411607E-4
ependymoma 2514 1.2323336163142E-4
primary pancreatic ductal adenocarcinoma 1271 4.47549575967062E-4
pediatric high grade glioma 2712 0.00137387965522938
glioblastoma 5572 0.00247543289325021
invasive ductal carcinoma 2950 0.00413337557727147
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.01265573134226
aldosterone-producing adenoma 664 0.0172040333770243
oligodendroglioma 2849 0.0212055204933937
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0345414178610907

Synonym

Accession Q8IVB5 Q6AI36
Symbols

Gene

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (1)

PMID Text
26310847 LIX1L is an RNA-binding protein, with implications for therapeutic approaches for targeting LIX1L in LIX1L-expressing cancer cells.

AA Sequence

METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGA      1 - 70
AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYVCYV     71 - 140
TLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHPSRRITDEFIEKSVSEALASFNGNREEADNPNT    141 - 210
GIGAFRFMLESNKGKSMLEFQELMTVFQLLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDW    211 - 280
VSREQSVPGALSRELASTERELDEARLAGKELRFHKEKKDILVLAAGQLGNMHSSNC                 281 - 337
//

Text Mined References (5)

PMID Year Title
26310847 2015 Novel roles for LIX1L in promoting cancer cell proliferation through ROS1-mediated LIX1L phosphorylation.
19710173 2009 Drosophila lowfat, a novel modulator of Fat signaling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.