Property Summary

NCBI Gene PubMed Count 30
PubMed Score 22.70
PubTator Score 18.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia -1.300 4.7e-02
Astrocytoma, Pilocytic 1.300 2.6e-06
atypical teratoid / rhabdoid tumor -1.200 5.6e-04
breast carcinoma -1.200 3.3e-03
ductal carcinoma in situ -1.100 3.2e-03
fibroadenoma -1.500 1.5e-02
glioblastoma 1.200 3.2e-03
group 3 medulloblastoma -1.600 1.9e-04
intraductal papillary-mucinous carcinoma... -1.100 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.300 9.6e-03
invasive ductal carcinoma -1.200 3.5e-03
lung adenocarcinoma -1.300 1.5e-06
medulloblastoma, large-cell -1.700 4.7e-05
mucosa-associated lymphoid tissue lympho... 2.076 1.3e-02
osteosarcoma -1.425 1.9e-03
ovarian cancer -1.700 6.1e-14
tuberculosis 2.100 1.6e-09

Gene RIF (19)

AA Sequence

MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYAT      1 - 70
APTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLP     71 - 140
PIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGLIMYGFVKAMIHAGQLKNGDFHFTDCLFFGSL    141 - 210
MSATDPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDAAAFFQSVGNFLG    211 - 280
IFAGSFAMGSAYAIITALLTKFTKLCEFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTY    281 - 350
NNLSSDSKIRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLN    351 - 420
LGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIR    421 - 490
VGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPIS    491 - 560
RLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGG    561 - 630
YELKLEQTLGQSQLN                                                           631 - 645
//

Text Mined References (36)

PMID Year Title