Property Summary

NCBI Gene PubMed Count 28
Grant Count 8
R01 Count 4
Funding $877,789.33
PubMed Score 16.92
PubTator Score 18.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
25915159 Taken together, our findings demonstrate that NHE9 can be an effective predictor of chemoradiotherapy response in esophageal squamous cell carcinoma
25914168 SLC9A9 appears to influence the differentiation of T cells to a proinflammatory fate and may have a broader role in multiple sclerosis disease activity. There is an association between rs9828519(G) and nonresponse to IFNbeta treatment.
25835977 the expression of SLC9A9 can be a prognostic predictor for ESCC.
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
24065030 Loss-of-function mutations in NHE9 may contribute to autistic phenotype by modulating synaptic membrane protein expression and neurotransmitter clearance.
23508127 find interesting gene expression changes in endosomal NHE6 and NHE9 in postmortem autism brains.
21908519 33 directly measured and 13 derived glycosylation traits in 3533 individuals were identified and three novel gene association (MGAT5, B3GAT1 and SLC9A9) were identified using an additional European cohort.
21555518 SLC9A9 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21171650 This review defines NHE6-9 as organellar NHEs that are fairly dynamic, implying that they are subjected to intracellular trafficking and thus they continuously shuttle between organelles and the plasma membrane.
20732626 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYAT      1 - 70
APTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLP     71 - 140
PIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGLIMYGFVKAMIHAGQLKNGDFHFTDCLFFGSL    141 - 210
MSATDPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDAAAFFQSVGNFLG    211 - 280
IFAGSFAMGSAYAIITALLTKFTKLCEFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTY    281 - 350
NNLSSDSKIRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLN    351 - 420
LGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIR    421 - 490
VGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPIS    491 - 560
RLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGG    561 - 630
YELKLEQTLGQSQLN                                                           631 - 645
//

Text Mined References (34)

PMID Year Title
25915159 2015 NHE9 induces chemoradiotherapy resistance in esophageal squamous cell carcinoma by upregulating the Src/Akt/?-catenin pathway and Bcl-2 expression.
25914168 2015 A pharmacogenetic study implicates SLC9a9 in multiple sclerosis disease activity.
25835977 2015 Prognostic significance of SLC9A9 in patients with resectable esophageal squamous cell carcinoma.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24065030 2013 Functional evaluation of autism-associated mutations in NHE9.
23508127 2014 Genes for endosomal NHE6 and NHE9 are misregulated in autism brains.
23374588 2013 Pharmacogenomics in Alzheimer's disease: a genome-wide association study of response to cholinesterase inhibitors.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
More...