Property Summary

NCBI Gene PubMed Count 8
Grant Count 40
R01 Count 29
Funding $4,257,504.01
PubMed Score 15.84
PubTator Score 39.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.300 0.000
group 4 medulloblastoma -1.400 0.048
atypical teratoid/rhabdoid tumor -1.400 0.003
fibroadenoma 1.400 0.003
adult high grade glioma -1.700 0.017
pilocytic astrocytoma -1.200 0.029
subependymal giant cell astrocytoma -2.319 0.016
inflammatory breast cancer -1.400 0.022
psoriasis -1.100 0.000

Gene RIF (2)

PMID Text
18768681 characterization of the mouse 136 aa conserved isoform, Ret-PCP2
16298104 The data demonstrate that PCP-2 is a comparatively weak GoLoco motif protein that exhibits highest affinity interactions and GDI activity toward Galphai1, Galphai2, and Galphai3 subunits.

AA Sequence

MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDML      1 - 70
ASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP         71 - 136
//

Text Mined References (9)

PMID Year Title
18768681 2008 Retinal ON bipolar cells express a new PCP2 splice variant that accelerates the light response.
17215137 2007 A promoter element with enhancer properties, and the orphan nuclear receptor RORalpha, are required for Purkinje cell-specific expression of a Gi/o modulator.
16298104 2006 G-protein alpha subunit interaction and guanine nucleotide dissociation inhibitor activity of the dual GoLoco motif protein PCP-2 (Purkinje cell protein-2).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399102 2002 Conservation of the developmentally regulated dendritic localization of a Purkinje cell-specific mRNA that encodes a G-protein modulator: comparison of rodent and human Pcp2(L7) gene structure and expression.
10196137 1999 Interaction of heterotrimeric G protein Galphao with Purkinje cell protein-2. Evidence for a novel nucleotide exchange factor.