Property Summary

NCBI Gene PubMed Count 8
PubMed Score 15.84
PubTator Score 39.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.43177137736272E-11
ependymoma 2514 5.95152959983841E-5
glioblastoma 5572 4.39519326318691E-4
atypical teratoid/rhabdoid tumor 1095 0.00281353437064486
fibroadenoma 557 0.0029784546865973
subependymal giant cell astrocytoma 2287 0.016288031256399
adult high grade glioma 2148 0.017141425102417
inflammatory breast cancer 404 0.0219556363534956
pilocytic astrocytoma 3086 0.0286536320678715
group 4 medulloblastoma 1875 0.0480943445117338
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 7 13 3.778 1.9
Hypothyroidism 89 3.607 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.300 0.000
group 4 medulloblastoma -1.400 0.048
atypical teratoid/rhabdoid tumor -1.400 0.003
fibroadenoma 1.400 0.003
adult high grade glioma -1.700 0.017
pilocytic astrocytoma -1.200 0.029
subependymal giant cell astrocytoma -2.319 0.016
inflammatory breast cancer -1.400 0.022
psoriasis -1.100 0.000

Synonym

Accession Q8IVA1 M0R2R7 Q3KRG7
Symbols GPSM4

Gene

  Ortholog (8)

Gene RIF (2)

PMID Text
18768681 characterization of the mouse 136 aa conserved isoform, Ret-PCP2
16298104 The data demonstrate that PCP-2 is a comparatively weak GoLoco motif protein that exhibits highest affinity interactions and GDI activity toward Galphai1, Galphai2, and Galphai3 subunits.

AA Sequence

MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDML      1 - 70
ASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP         71 - 136
//

Text Mined References (9)

PMID Year Title
18768681 2008 Retinal ON bipolar cells express a new PCP2 splice variant that accelerates the light response.
17215137 2007 A promoter element with enhancer properties, and the orphan nuclear receptor RORalpha, are required for Purkinje cell-specific expression of a Gi/o modulator.
16298104 2006 G-protein alpha subunit interaction and guanine nucleotide dissociation inhibitor activity of the dual GoLoco motif protein PCP-2 (Purkinje cell protein-2).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399102 2002 Conservation of the developmentally regulated dendritic localization of a Purkinje cell-specific mRNA that encodes a G-protein modulator: comparison of rodent and human Pcp2(L7) gene structure and expression.
10196137 1999 Interaction of heterotrimeric G protein Galphao with Purkinje cell protein-2. Evidence for a novel nucleotide exchange factor.