Property Summary

NCBI Gene PubMed Count 8
PubMed Score 15.84
PubTator Score 39.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 1.7e-02
Astrocytoma, Pilocytic -1.200 2.7e-02
atypical teratoid / rhabdoid tumor -1.300 3.4e-03
ependymoma -1.300 6.0e-05
fibroadenoma 1.400 3.0e-03
glioblastoma -1.300 4.4e-04
group 4 medulloblastoma -1.400 4.8e-02
inflammatory breast cancer -1.400 2.2e-02
psoriasis -1.100 3.4e-11
subependymal giant cell astrocytoma -2.319 1.6e-02

Synonym

Accession Q8IVA1 M0R2R7 Q3KRG7
Symbols GPSM4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDML      1 - 70
ASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP         71 - 136
//

Text Mined References (9)

PMID Year Title