Property Summary

Ligand Count 44
NCBI Gene PubMed Count 33
PubMed Score 36.29
PubTator Score 24.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lupus Erythematosus, Systemic 67 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 3.0

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial cystitis 1.900 8.9e-04
invasive ductal carcinoma 2.207 8.9e-05
lung cancer -1.400 9.7e-03
osteosarcoma -1.517 5.0e-03
ovarian cancer 1.300 1.1e-08
progressive supranuclear palsy -1.100 2.1e-02
sarcoidosis 1.100 1.1e-02
tuberculosis -1.200 2.7e-05
ulcerative colitis 1.400 8.6e-04

Gene RIF (14)

AA Sequence

MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEF      1 - 70
RLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSK     71 - 140
KGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVL    141 - 210
SKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSS    211 - 280
NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL    281 - 350
EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH    351 - 420
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMG    421 - 490
PGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSL    491 - 560
PGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGS    561 - 630
HTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG              631 - 690
//

Text Mined References (35)

PMID Year Title