Property Summary

NCBI Gene PubMed Count 29
Grant Count 18
R01 Count 9
Funding $4,571,278.69
PubMed Score 32.96
PubTator Score 24.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.517 0.005
tuberculosis -1.200 0.000
lung cancer -1.900 0.000
sarcoidosis 1.100 0.011
interstitial cystitis 1.900 0.001
invasive ductal carcinoma 2.207 0.000
progressive supranuclear palsy -1.100 0.021
ulcerative colitis 1.400 0.001
ovarian cancer 1.300 0.000

Gene RIF (12)

PMID Text
24779681 Ras activator RasGRP3 may have a role in the pathological behavior of breast cancer cells and may constitute a therapeutic target for human breast cancer.
24418912 Knockdown of RasGRP3 inhibited proliferation in prostate neoplasms.
21602881 The identification of the role of RasGRP3 in melanoma highlights its importance, as a Ras activator, in the phosphoinositide signaling pathway in human melanoma.
20876802 RasGRP3 contributes to the malignant phenotype of prostate cancer cells and may constitute a novel therapeutic target for human prostate cancer.
20516000 Significant associations were found for the single nucleotide polymorphism rs13385731 of RasGRP3 with malar rash, discoid rash, and antinuclear antibody in patients with systemic lupus erythematosus
20516000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19421330 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17012239 dynein light chain 1 represents a novel anchoring protein for RasGRP3 that may regulate subcellular localization of the exchange factor
More...

AA Sequence

MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEF      1 - 70
RLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSK     71 - 140
KGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVL    141 - 210
SKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSS    211 - 280
NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL    281 - 350
EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH    351 - 420
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMG    421 - 490
PGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSL    491 - 560
PGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGS    561 - 630
HTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG              631 - 690
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24779681 2014 Function of RasGRP3 in the formation and progression of human breast cancer.
24418912 2014 Upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
21602881 2011 RasGRP3, a Ras activator, contributes to signaling and the tumorigenic phenotype in human melanoma.
20876802 2010 RasGRP3 contributes to formation and maintenance of the prostate cancer phenotype.
20516000 2010 TNIP1, SLC15A4, ETS1, RasGRP3 and IKZF1 are associated with clinical features of systemic lupus erythematosus in a Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19421330 2009 Genome-wide association study of young-onset hypertension in the Han Chinese population of Taiwan.
More...