Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.48
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IV56
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19605793 Proline-rich 15 is required for conceptus elongation and survival during early ovine pregnancy.

AA Sequence

MADSGDAGSSGPWWKSLTNSRKKSKEAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSRENQHPNLLGGAGE      1 - 70
PPKPDKLYGDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDKQ                71 - 129
//

Text Mined References (6)

PMID Year Title
21061267 2011 Expression analysis of proline rich 15 (Prr15) in mouse and human gastrointestinal tumors.
19605793 2009 The involvement of proline-rich 15 in early conceptus development in sheep.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.