Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.21
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (2)

AA Sequence

MADSGDAGSSGPWWKSLTNSRKKSKEAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSRENQHPNLLGGAGE      1 - 70
PPKPDKLYGDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDKQ                71 - 129
//

Text Mined References (7)

PMID Year Title