Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.416 3.7e-03
acute quadriplegic myopathy 1.142 9.2e-05
adult high grade glioma -1.200 2.0e-04
astrocytic glioma -1.300 2.3e-02
atypical teratoid / rhabdoid tumor -2.500 1.9e-09
ependymoma -1.700 3.6e-02
glioblastoma -1.100 2.0e-05
intraductal papillary-mucinous carcinoma... -1.200 2.3e-02
juvenile dermatomyositis 1.110 5.3e-08
medulloblastoma -1.300 1.0e-06
medulloblastoma, large-cell -1.600 2.8e-06
ovarian cancer -2.000 6.7e-06
primary Sjogren syndrome 1.800 1.4e-05
primitive neuroectodermal tumor -1.400 5.2e-04
subependymal giant cell astrocytoma -1.155 2.7e-02
ulcerative colitis 1.900 1.1e-07

AA Sequence

MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERH      1 - 70
VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISEKPLLFNGLNSIDSPENETAD     71 - 140
NSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYAT    141 - 210
SLYHS                                                                     211 - 215
//

Text Mined References (9)

PMID Year Title