Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.88316112599134E-9
juvenile dermatomyositis 1189 5.25148978352397E-8
ulcerative colitis 2087 1.08808627779101E-7
medulloblastoma 1524 1.0191312193051E-6
medulloblastoma, large-cell 6234 2.7696532614275E-6
ovarian cancer 8492 6.74897186199495E-6
primary Sjogren syndrome 789 1.35304984993905E-5
glioblastoma 5572 2.58960484511089E-5
pediatric high grade glioma 2712 2.980500383989E-5
acute quadriplegic myopathy 1157 9.18613479037935E-5
primitive neuroectodermal tumor 3031 5.15920778761799E-4
active Crohn's disease 918 0.00370739220573088
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0225464793693914
astrocytic glioma 2241 0.022823827557844
subependymal giant cell astrocytoma 2287 0.0273952492793592
ependymoma 2514 0.0362611461035181

Expression

Synonym

Accession Q8IV50 Q5CZ88 Q8WTV3
Symbols

Gene

  Ortholog (11)

 Compartment GO Term (2)

AA Sequence

MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERH      1 - 70
VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISEKPLLFNGLNSIDSPENETAD     71 - 140
NSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYAT    141 - 210
SLYHS                                                                     211 - 215
//

Text Mined References (9)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.