Property Summary

NCBI Gene PubMed Count 14
PubMed Score 87.76
PubTator Score 20.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 2.1e-05
Astrocytoma, Pilocytic 1.100 7.3e-06
atypical teratoid / rhabdoid tumor 1.300 4.1e-04
Breast cancer 2.300 4.0e-02
ependymoma 1.400 1.7e-10
glioblastoma 1.600 2.6e-07
group 3 medulloblastoma 2.600 6.3e-07
medulloblastoma, large-cell 1.700 4.5e-05
non primary Sjogren syndrome sicca -1.100 2.1e-02
ovarian cancer -1.300 2.2e-06
primitive neuroectodermal tumor 1.400 4.3e-04
subependymal giant cell astrocytoma 1.894 2.6e-02
ulcerative colitis 1.200 8.5e-08

Gene RIF (6)

AA Sequence

MEDPQSKEPAGEAVALALLESPRPEGGEEPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIA      1 - 70
ITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCE     71 - 140
EGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKV    141 - 210
IDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM    211 - 280
LEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK     281 - 349
//

Text Mined References (19)

PMID Year Title