Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.89
PubTator Score 3.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
esophageal cancer 22 0.0 3.0
Disease Target Count Z-score Confidence
Cardia cancer 3 4.491 2.2

Expression

  Differential Expression (6)

Synonym

Accession Q8IV45 Q5TGU1
Symbols ZUD
MUXA

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNGQEEPVSQPTPQLENEVSRQHLP      1 - 70
ATLPEMVAFYQELHTPTQGQTMVRQLMHKLLVFSAREVDHRGGCLMLQDTGISLLIPPGAVAVGRQERVS     71 - 140
LILVWDLSDAPSLSQAQGLVSPVVACGPHGASFLKPCTLTFKHCAEQPSHARTYSSNTTLLDAKVWRPLG    141 - 210
RPGAHASRDECRIHLSHFSLYTCVLEAPVGREARKWLQLAVFCSPLVPGQSHLQLRIYFLNNTPCALQWA    211 - 280
LTNEQPHGGRLRGPCQLFDFNGARGDQCLKLTYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKA    281 - 350
ADENEDCSALTNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLL    351 - 420
EPNSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAILELFEEQNGSLQELHYLMTVMERLDCASAIQNY    421 - 490
LSGTHGGSPGPERGGARDNQGLELDEKL                                              491 - 518
//

Text Mined References (7)

PMID Year Title