Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.89
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (2)

PMID Text
22158417 The death domain-containing protein Unc5CL is a novel MyD88-independent activator of the pro-inflammatory IRAK signaling cascade.
14769797 ZUD is an inhibitor of NF-kappaB activation and may provide an alternative regulatory mechanism for NF-kappaB-mediated transcription

AA Sequence

MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNGQEEPVSQPTPQLENEVSRQHLP      1 - 70
ATLPEMVAFYQELHTPTQGQTMVRQLMHKLLVFSAREVDHRGGCLMLQDTGISLLIPPGAVAVGRQERVS     71 - 140
LILVWDLSDAPSLSQAQGLVSPVVACGPHGASFLKPCTLTFKHCAEQPSHARTYSSNTTLLDAKVWRPLG    141 - 210
RPGAHASRDECRIHLSHFSLYTCVLEAPVGREARKWLQLAVFCSPLVPGQSHLQLRIYFLNNTPCALQWA    211 - 280
LTNEQPHGGRLRGPCQLFDFNGARGDQCLKLTYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKA    281 - 350
ADENEDCSALTNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLL    351 - 420
EPNSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAILELFEEQNGSLQELHYLMTVMERLDCASAIQNY    421 - 490
LSGTHGGSPGPERGGARDNQGLELDEKL                                              491 - 518
//

Text Mined References (6)

PMID Year Title
22158417 2012 The death domain-containing protein Unc5CL is a novel MyD88-independent activator of the pro-inflammatory IRAK signaling cascade.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14769797 2004 Identification of a ZU5 and death domain-containing inhibitor of NF-kappaB.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.