Property Summary

NCBI Gene PubMed Count 5
PubMed Score 18.05
PubTator Score 1.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.500 1.3e-04
atypical teratoid / rhabdoid tumor -1.700 8.9e-05
glioblastoma -1.300 2.5e-03
group 4 medulloblastoma -1.600 1.1e-04
medulloblastoma, large-cell -1.200 9.7e-04

Gene RIF (1)

AA Sequence

MKTAENIRGTGSDGPRKRGLCVLCGLPAAGKSTFARALAHRLQQEQGWAIGVVAYDDVMPDAFLAGARAR      1 - 70
PAPSQWKLLRQELLKYLEYFLMAVINGCQMSVPPNRTEAMWEDFITCLKDQDLIFSAAFEAQSCYLLTKT     71 - 140
AVSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQRPQALPPETIHLMGRKLE    141 - 210
KPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAEDNMEQKDTDRIICSTNILHKTDQTL    211 - 280
RRIVSQTMKEAKGNQEAFSEMTFKQRWVRANHAAIWRIILGNEHIKCRSAKVGWLQCCRIEKRPLSTG      281 - 348
//

Text Mined References (6)

PMID Year Title