Property Summary

NCBI Gene PubMed Count 5
PubMed Score 17.14
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.003
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.200 0.001
adult high grade glioma -1.500 0.000

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKTAENIRGTGSDGPRKRGLCVLCGLPAAGKSTFARALAHRLQQEQGWAIGVVAYDDVMPDAFLAGARAR      1 - 70
PAPSQWKLLRQELLKYLEYFLMAVINGCQMSVPPNRTEAMWEDFITCLKDQDLIFSAAFEAQSCYLLTKT     71 - 140
AVSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQRPQALPPETIHLMGRKLE    141 - 210
KPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAEDNMEQKDTDRIICSTNILHKTDQTL    211 - 280
RRIVSQTMKEAKGNQEAFSEMTFKQRWVRANHAAIWRIILGNEHIKCRSAKVGWLQCCRIEKRPLSTG      281 - 348
//

Text Mined References (6)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15317934 2004 Identification and characterization of phosphoseryl-tRNA[Ser]Sec kinase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.