Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.83
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 9.54376156828599E-10
medulloblastoma, large-cell 6234 5.19315253621734E-5
atypical teratoid / rhabdoid tumor 4369 5.97520694397423E-4
lung cancer 4473 0.00118202362187005
dermatomyositis 967 0.00257004377082501
Pick disease 1893 0.00320196010344101
astrocytic glioma 2241 0.0384811165138393
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0414956742551508
colon cancer 1475 0.0470310435359689

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 0.038
atypical teratoid / rhabdoid tumor -1.100 0.001
medulloblastoma, large-cell -2.000 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.041
colon cancer -1.500 0.047
lung cancer 1.700 0.001
Pick disease -1.300 0.003
ovarian cancer -2.800 0.000
dermatomyositis 1.100 0.003

Synonym

Accession Q8IV38 A4D124 Q659G1 Q96BL3
Symbols ZMYND20

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

AA Sequence

MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGA      1 - 70
DVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRER     71 - 140
LDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVMLVNENPLLTEEAALNKCYRVMDLICEKCMK    141 - 210
QRDMNEVLAMKMHYISCIFQKCINFLKDGENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEAT    211 - 280
LLQQLVRSIAPVEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHW    281 - 350
FTHKKICKNLKDIYEKQQLEAAKEKRQEENHGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSGEGKKESL    351 - 420
ESEAELEGLQDAPAGPQVSEE                                                     421 - 441
//

Text Mined References (10)

PMID Year Title
25077969 2014 Role of the ANKMY2-FKBP38 axis in regulation of the Sonic hedgehog (Shh) signaling pathway.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.