Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.92
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 3.8e-02
atypical teratoid / rhabdoid tumor -1.100 6.0e-04
colon cancer -1.500 4.7e-02
dermatomyositis 1.100 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.600 4.1e-02
lung cancer 1.700 1.2e-03
medulloblastoma, large-cell -2.000 5.2e-05
ovarian cancer -2.800 9.5e-10
Pick disease -1.300 3.2e-03

AA Sequence

MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGA      1 - 70
DVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRER     71 - 140
LDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVMLVNENPLLTEEAALNKCYRVMDLICEKCMK    141 - 210
QRDMNEVLAMKMHYISCIFQKCINFLKDGENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEAT    211 - 280
LLQQLVRSIAPVEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHW    281 - 350
FTHKKICKNLKDIYEKQQLEAAKEKRQEENHGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSGEGKKESL    351 - 420
ESEAELEGLQDAPAGPQVSEE                                                     421 - 441
//

Text Mined References (10)

PMID Year Title