Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.96
PubTator Score 5.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis 1.355 3.7e-03
ependymoma -1.100 5.0e-10
group 3 medulloblastoma -1.200 1.2e-02
invasive ductal carcinoma 1.700 8.6e-04
lung carcinoma 1.500 1.2e-18
psoriasis -1.200 5.1e-30
subependymal giant cell astrocytoma -1.425 4.5e-02

Synonym

Accession Q8IV36 Q8N5L6 Q8TE83 Q9NT34
Symbols DMC1
HID-1
17orf28
C17orf28

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLC      1 - 70
YKAVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEDDEHARP     71 - 140
LAESLLLAIADLLFCPDFTVQSHRRSTVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKL    141 - 210
LLTCFSEAMYLPPAPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPL    211 - 280
VEEAAQVLIVTLDHDSASSASPTVDGTTTGTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLS    281 - 350
NPLLQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILFFLNDARADQSRVGLMH    351 - 420
IGVFILLLLSGERNFGVRLNKPYSIRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVN    421 - 490
VSPYLKSLSMVTANKLLHLLEAFSTTWFLFSAAQNHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRSI    491 - 560
FHQLANLPTDPPTIHKALQRRRRTPEPLSRTGSQEGTSMEGSRPAAPAEPGTLKTSLVATPGIDKLTEKS    561 - 630
QVSEDGTLRSLEPEPQQSLEDGSPAKGEPSQAWREQRRPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRL    631 - 700
LQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNV    701 - 770
DPPVWYDTDVKLFEIQRV                                                        771 - 788
//

Text Mined References (17)

PMID Year Title