Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.32
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.008 0.030
non-small cell lung cancer -2.416 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.011
diabetes mellitus 1.200 0.001
interstitial cystitis -1.700 0.001
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.100 0.000
Breast cancer -1.400 0.002
ovarian cancer 2.500 0.000
pituitary cancer -1.100 0.000
psoriasis -1.400 0.000

Gene RIF (2)

PMID Text
26049106 presented data demonstrate that TMEM139 interacts with kAE1 and promotes its intracellular trafficking
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVPMHLLGRLEKPLLLLCCASFLLGLALLGIKTDITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSM      1 - 70
QTESPGPSGNARDNEAFEVPVYEEAVVGLESQCRPQELDQPPPYSTVVIPPAPEEEQPSHPEGSRRAKLE     71 - 140
QRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSLAAVPTLEPLTPPPAYDVCFGHPDDDSVFYE    141 - 210
DNWAPP                                                                    211 - 216
//

Text Mined References (16)

PMID Year Title
26049106 2015 Transmembrane protein 139 (TMEM139) interacts with human kidney isoform of anion exchanger 1 (kAE1).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...