Property Summary

NCBI Gene PubMed Count 42
PubMed Score 79.61
PubTator Score 42.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.200 1.4e-03
Breast cancer -2.800 2.7e-02
breast carcinoma -2.700 1.1e-04
ductal carcinoma in situ -2.700 3.0e-05
fibroadenoma -2.500 1.2e-02
invasive ductal carcinoma -3.100 8.8e-05
lung adenocarcinoma -4.500 2.5e-22
non-small cell lung cancer -3.291 1.3e-28
osteosarcoma -2.647 1.2e-04
pediatric high grade glioma -1.100 7.9e-03
psoriasis -1.100 3.0e-20
subependymal giant cell astrocytoma -1.410 1.0e-02

Gene RIF (33)

AA Sequence

MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKS      1 - 70
LPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPP     71 - 140
WQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP                              141 - 184
//

Text Mined References (43)

PMID Year Title