Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
active ulcerative colitis -1.220 1.5e-02
lung adenocarcinoma 1.200 4.6e-04
malignant mesothelioma 3.900 3.9e-08
medulloblastoma, large-cell 1.500 2.5e-02
osteosarcoma -1.938 4.8e-05

Synonym

Accession Q8IV13 Q6ZN43 Q9H7W8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

AA Sequence

MMDEPWWEGRVASDVHCTLREKELKLPTFRAHSPLLKSRRFFVDILTLLSSHCQLCPAARHLAVYLLDHF      1 - 70
MDRYNVTTSKQLYTVAVSCLLLANGVSLLSPRLKCSGMISAHCNLHLPGSSNSPASAPHPPPTPPQVAET     71 - 140
TGKFEDREDHVPKLEQINSTRILSSQNFTLTKKELLSTELLLLEAFSWNLCLPTPAHFLDYYLLASVSQK    141 - 210
DHHCHTWPTTCPRKTKECLKEYAHYFLEVTLQDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRIS    211 - 280
SYSLEHLSTCIEILLVVYDNVLKDAVAVKSQALAMVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPV    281 - 350
QDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSS    351 - 420
YFSGSHMFPTGCFDR                                                           421 - 435
//

Text Mined References (3)

PMID Year Title