Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 3.900 0.000
osteosarcoma -1.938 0.000
medulloblastoma, large-cell 1.500 0.025
active ulcerative colitis -1.220 0.015
lung adenocarcinoma 1.200 0.000

AA Sequence

MMDEPWWEGRVASDVHCTLREKELKLPTFRAHSPLLKSRRFFVDILTLLSSHCQLCPAARHLAVYLLDHF      1 - 70
MDRYNVTTSKQLYTVAVSCLLLANGVSLLSPRLKCSGMISAHCNLHLPGSSNSPASAPHPPPTPPQVAET     71 - 140
TGKFEDREDHVPKLEQINSTRILSSQNFTLTKKELLSTELLLLEAFSWNLCLPTPAHFLDYYLLASVSQK    141 - 210
DHHCHTWPTTCPRKTKECLKEYAHYFLEVTLQDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRIS    211 - 280
SYSLEHLSTCIEILLVVYDNVLKDAVAVKSQALAMVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPV    281 - 350
QDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSS    351 - 420
YFSGSHMFPTGCFDR                                                           421 - 435
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.