Property Summary

NCBI Gene PubMed Count 22
Grant Count 21
R01 Count 18
Funding $1,905,612.46
PubMed Score 59.98
PubTator Score 38.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis 1.200 0.001
astrocytoma -1.400 0.000
oligodendroglioma -1.700 0.000
osteosarcoma 1.193 0.023
posterior fossa group B ependymoma -1.500 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.000
group 3 medulloblastoma -1.300 0.033
ovarian cancer 1.900 0.000

 GO Process (1)

Gene RIF (9)

PMID Text
26411346 Rare Variants in PLD3 Do Not Affect Risk for Early-Onset Alzheimer Disease in a European Consortium Cohort
26402410 one PLD3 variant (rs11667768) was associated with amyloid burden detected by CSF in normal individuals, suggesting the potential role of PLD3 in Abeta pathology
24866402 The rare coding variant might not play an important role in AD risk in mainland China.
24336208 genetic and functional data indicate that carriers of PLD3 coding variants have a twofold increased risk for late-onset Alzheimer's disease and that PLD3 influences APP processing
21752829 PLD3 localizes to lysosomes
20112697 PLD3 overexpression may inhibit Akt phosphorylation and further block the transduction of insulin signaling in C2C12 cells.
19525236 receptor stimulation leads to sequestration of recycling endosomes in a classical protein kinase C- and phospholipase D-dependent manner
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16580565 Our data do not support the hypothesis that the HindIII(+/-) site of the Y chromosome is a marker of cardiovascular risk in white men, highlighting the need for replication in genetic association studies.

AA Sequence

MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGP      1 - 70
NQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPS     71 - 140
AQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQT    141 - 210
HFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPME    211 - 280
ICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLR    281 - 350
RATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM    351 - 420
VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL    421 - 490
//

Text Mined References (31)

PMID Year Title
26411346 2015 Rare Variants in PLD3 Do Not Affect Risk for Early-Onset Alzheimer Disease in a European Consortium Cohort.
26402410 2015 Common Variants in PLD3 and Correlation to Amyloid-Related Phenotypes in Alzheimer's Disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25832413 2015 PLD3 gene variants and Alzheimer's disease.
25832411 2015 PLD3 in non-familial Alzheimer's disease.
25832410 2015 PLD3 variants in population studies.
25832409 2015 Cruchaga & Goate reply.
25832408 2015 PLD3 and sporadic Alzheimer's disease risk.
24866402 2014 Investigation of TREM2, PLD3, and UNC5C variants in patients with Alzheimer's disease from mainland China.
24336208 2014 Rare coding variants in the phospholipase D3 gene confer risk for Alzheimer's disease.
More...