Property Summary

NCBI Gene PubMed Count 24
PubMed Score 62.09
PubTator Score 38.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.400 6.7e-21
ependymoma -1.200 1.3e-05
group 3 medulloblastoma -1.300 3.3e-02
intraductal papillary-mucinous neoplasm ... -1.200 3.0e-04
malignant mesothelioma 1.200 2.5e-05
oligodendroglioma -1.700 2.6e-23
osteosarcoma 1.193 2.3e-02
ovarian cancer 1.900 4.2e-06
psoriasis 1.200 6.4e-04

Gene RIF (12)

AA Sequence

MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGP      1 - 70
NQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPS     71 - 140
AQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQT    141 - 210
HFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPME    211 - 280
ICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLR    281 - 350
RATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM    351 - 420
VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL    421 - 490
//

Text Mined References (33)

PMID Year Title