Property Summary

NCBI Gene PubMed Count 11
Grant Count 7
Funding $251,764.98
PubMed Score 9.44
PubTator Score 7.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.860 0.000
non-small cell lung cancer -1.376 0.000
interstitial cystitis 1.800 0.002
lung adenocarcinoma -1.100 0.001

Gene RIF (5)

PMID Text
23109291 Carabin as a new negative regulator of B-cell function, whose deficiency in B cells speeds up early B-cell responses
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17230191 Carabin is a negative feedback inhibitor of the calcineurin signalling pathway that also mediates crosstalk between calcineurin and Ras
17230191 Carabin inhibits calcineurin and Ras and was identified by a yeast-two-hybrid screen with calcineurin

AA Sequence

MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEM      1 - 70
TSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLH     71 - 140
RQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPG    141 - 210
YYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEG    211 - 280
ARVLFRVGLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQL    281 - 350
AQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLL    351 - 420
TRARGPPIEGPPRPQRGSTSFLDTRF                                                421 - 446
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23109291 2012 Carabin deficiency in B cells increases BCR-TLR9 costimulation-induced autoimmunity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20404108 2010 Regulation of exosome secretion by Rab35 and its GTPase-activating proteins TBC1D10A-C.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903851 2009 Calcineurin inhibitors activate the proto-oncogene Ras and promote protumorigenic signals in renal cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
More...