Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 4.38869212107525E-13
pituitary cancer 1972 6.07686979951841E-10
ovarian cancer 8492 1.21425227535872E-8
lung carcinoma 2844 5.29459389334493E-8
posterior fossa group B ependymoma 1530 4.0342515017361E-7
pilocytic astrocytoma 3086 8.23831279864846E-4
adrenocortical carcinoma 1427 0.00150007032404317
oligodendroglioma 2849 0.00370251872652893
Polycystic Ovary Syndrome 335 0.00658690224115015
subependymal giant cell astrocytoma 2287 0.00890811589283509
aldosterone-producing adenoma 664 0.0371607661447353
Disease Target Count
Common variable immunodeficiency 98

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -1.700 0.000
oligodendroglioma -1.100 0.004
adrenocortical carcinoma -1.846 0.002
lung adenocarcinoma -1.200 0.000
pilocytic astrocytoma -1.200 0.001
aldosterone-producing adenoma -1.247 0.037
subependymal giant cell astrocytoma -2.261 0.009
Polycystic Ovary Syndrome -1.081 0.007
lung carcinoma -1.300 0.000
ovarian cancer -1.800 0.000
pituitary cancer -2.400 0.000

Synonym

Accession Q8IV03 Q5VZX7 Q8N923 Q8NCG2
Symbols LRAP35b
bA3L8.2
C9orf150
HYST0841

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MEDSPLPDLRDIELKLGRKVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGGGGCSSSSSYCSFPP      1 - 70
SLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKWMIEEKAT     71 - 140
ITSRGSSLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGISVGSYLDTLADDVPGHQTPSDLDQFSDSSL    141 - 210
IEDSQALHKRPKLDSEYYCFG                                                     211 - 231
//

Text Mined References (9)

PMID Year Title
25107909 2014 Adaptor protein LRAP25 mediates myotonic dystrophy kinase-related Cdc42-binding kinase (MRCK) regulation of LIMK1 protein in lamellipodial F-actin dynamics.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.