Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.846 1.5e-03
aldosterone-producing adenoma -1.247 3.7e-02
Astrocytoma, Pilocytic -1.200 8.0e-04
ependymoma -1.200 1.1e-02
lung adenocarcinoma -1.200 4.4e-13
lung carcinoma -1.300 5.3e-08
oligodendroglioma -1.100 3.7e-03
ovarian cancer -1.800 1.2e-08
pituitary cancer -2.400 6.1e-10
Polycystic ovary syndrome -1.081 6.6e-03
subependymal giant cell astrocytoma -2.261 8.9e-03

Synonym

Accession Q8IV03 Q5VZX7 Q8N923 Q8NCG2
Symbols LRAP35b
bA3L8.2
C9orf150
HYST0841

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MEDSPLPDLRDIELKLGRKVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGGGGCSSSSSYCSFPP      1 - 70
SLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKWMIEEKAT     71 - 140
ITSRGSSLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGISVGSYLDTLADDVPGHQTPSDLDQFSDSSL    141 - 210
IEDSQALHKRPKLDSEYYCFG                                                     211 - 231
//

Text Mined References (9)

PMID Year Title