Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -1.700 0.000
oligodendroglioma -1.100 0.004
adrenocortical carcinoma -1.846 0.002
lung adenocarcinoma -1.200 0.000
pilocytic astrocytoma -1.200 0.001
aldosterone-producing adenoma -1.247 0.037
subependymal giant cell astrocytoma -2.261 0.009
Polycystic Ovary Syndrome -1.081 0.007
lung carcinoma -1.300 0.000
ovarian cancer -1.800 0.000
pituitary cancer -2.400 0.000

Synonym

Accession Q8IV03 Q5VZX7 Q8N923 Q8NCG2
Symbols LRAP35b
bA3L8.2
C9orf150
HYST0841

Gene

 Compartment GO Term (0)

AA Sequence

MEDSPLPDLRDIELKLGRKVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGGGGCSSSSSYCSFPP      1 - 70
SLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKWMIEEKAT     71 - 140
ITSRGSSLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGISVGSYLDTLADDVPGHQTPSDLDQFSDSSL    141 - 210
IEDSQALHKRPKLDSEYYCFG                                                     211 - 231
//

Text Mined References (9)

PMID Year Title
25107909 2014 Adaptor protein LRAP25 mediates myotonic dystrophy kinase-related Cdc42-binding kinase (MRCK) regulation of LIMK1 protein in lamellipodial F-actin dynamics.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.