Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.67
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 7.1e-06
atypical teratoid / rhabdoid tumor -1.400 1.3e-06
ependymoma -1.600 1.6e-11
glioblastoma -1.300 2.5e-06
group 3 medulloblastoma -2.200 9.0e-05
lung adenocarcinoma 2.900 2.2e-06
medulloblastoma, large-cell -1.500 5.7e-04
osteosarcoma -1.932 4.2e-03
pediatric high grade glioma -1.100 7.6e-04
primitive neuroectodermal tumor -1.200 6.4e-04
subependymal giant cell astrocytoma -1.792 5.0e-02

Gene RIF (1)

AA Sequence

MAVDVAEYHLSVIKSPPGWEVGVYAAGALALLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESC      1 - 70
AEAREKRVPAWNAQRASTRGPPSRKGSLSIEDTFESISELGPLELMGRELDLAPYGTLRKSQSADSLNSI     71 - 140
SSVSNTFGQDFTLGQVEVSMEYDTASHTLNVAVMQGKDLLEREEASFESCFMRVSLLPDEQIVGISRIQR    141 - 210
NAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKA    211 - 280
ADAVGEILLSLSYLPTAERLTVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVF    281 - 350
NEAMIFSVPAIVLQDLSLRVTVAESSSDGRGDNVGHVIIGPSASGMGTTHWNQMLATLRRPVSMWHAVRR    351 - 420
N//

Text Mined References (8)

PMID Year Title