Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.65
PubTator Score 5.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer -1.074 5.7e-18
osteosarcoma -2.017 5.6e-05
ovarian cancer -1.100 1.5e-05
subependymal giant cell astrocytoma 1.340 5.4e-03
tuberculosis 1.500 1.8e-06

Gene RIF (2)

AA Sequence

MAADQRPKADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHVGHCHPLVVQA      1 - 70
AHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRLARHYTGHQDVVVLDHAY     71 - 140
HGHLSSLIDISPYKFRNLDGQKEWVHVAPLPDTYRGPYREDHPNPAMAYANEVKRVVSSAQEKGRKIAAF    141 - 210
FAESLPSVGGQIIPPAGYFSQVAEHIRKAGGVFVADEIQVGFGRVGKHFWAFQLQGKDFVPDIVTMGKSI    211 - 280
GNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQ    281 - 350
KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLD    351 - 420
NARQVVAKLDAILTDMEEKVRSCETLRLQP                                            421 - 450
//

Text Mined References (14)

PMID Year Title