Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma 2.900 0.000
non-small cell lung cancer -2.323 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.001
active Crohn's disease 1.819 0.001
lung adenocarcinoma -1.700 0.000
pilocytic astrocytoma 1.100 0.001
lung carcinoma -1.300 0.000
Breast cancer -1.700 0.000
ulcerative colitis 1.100 0.004
ovarian cancer 1.300 0.000

AA Sequence

MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKCGREGITLNKY      1 - 70
NQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFGKDIKVVIPVVSVQMIKKHKM     71 - 140
ARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMKWR    141 - 210
KVCPSSRSLSLPDNIPCIPPSSVDSTDSFFPSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPN    211 - 280
CSPTAKNAVYEEDELEEEPRSTGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPV    281 - 350
PGHR                                                                      351 - 354
//

Text Mined References (6)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.