Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.819 9.7e-04
Astrocytoma, Pilocytic 1.100 1.1e-03
Breast cancer -1.700 3.5e-05
ependymoma 1.700 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.5e-03
lung adenocarcinoma -1.300 6.0e-09
lung carcinoma -1.300 3.4e-13
non-small cell lung cancer -2.323 2.0e-20
ovarian cancer 1.300 6.5e-05
ulcerative colitis 1.100 3.6e-03

AA Sequence

MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKCGREGITLNKY      1 - 70
NQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFGKDIKVVIPVVSVQMIKKHKM     71 - 140
ARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMKWR    141 - 210
KVCPSSRSLSLPDNIPCIPPSSVDSTDSFFPSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPN    211 - 280
CSPTAKNAVYEEDELEEEPRSTGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPV    281 - 350
PGHR                                                                      351 - 354
//

Text Mined References (6)

PMID Year Title