Property Summary

NCBI Gene PubMed Count 11
PubMed Score 23.91
PubTator Score 11.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer 2.700 3.9e-02
cutaneous lupus erythematosus 2.100 1.7e-02
cystic fibrosis and chronic rhinosinusit... -1.608 4.3e-02
group 4 medulloblastoma -1.400 1.5e-02
head and neck cancer -1.600 2.0e-02
interstitial cystitis 1.500 2.2e-04
interstitial lung disease 1.300 1.6e-02
lung adenocarcinoma -1.200 3.8e-06
lung cancer -5.500 1.8e-07
ovarian cancer 3.000 3.0e-03
periodontitis 1.100 3.6e-23
pituitary cancer -1.400 2.1e-03
posterior fossa group B ependymoma -1.300 2.5e-04
psoriasis 2.300 9.1e-03
ulcerative colitis 1.500 1.2e-02

Gene RIF (4)

AA Sequence

MPLPWSLALPLLLSWVAGGFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGVCEATCEPGCK      1 - 70
FGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFCLSGHMLMPDATCVNSRTCAM     71 - 140
INCQYSCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQY    141 - 210
ISGRYDCIDINECTMDSHTCSHHANCFNTQGSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRI    211 - 280
KKLLAHKNSMKKKAKIKNVTPEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREE    281 - 350
KALKNDIEERSLRGDVFFPKVNEAGEFGLILVQRKALTSKLEHKDLNISVDCSFNHGICDWKQDREDDFD    351 - 420
WNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALA    421 - 490
WEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPDSLLSVDD           491 - 553
//

Text Mined References (16)

PMID Year Title