Property Summary

NCBI Gene PubMed Count 10
PubMed Score 19.14
PubTator Score 11.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
interstitial lung disease 1.300 0.016
cutaneous lupus erythematosus 2.100 0.017
psoriasis 2.300 0.009
group 4 medulloblastoma -1.400 0.015
periodontitis 1.100 0.000
lung cancer -5.500 0.000
Breast cancer 2.700 0.039
interstitial cystitis 1.500 0.000
posterior fossa group B ependymoma -1.300 0.000
lung adenocarcinoma -1.200 0.000
ulcerative colitis 1.500 0.012
ovarian cancer 3.000 0.003
pituitary cancer -1.400 0.002
cystic fibrosis and chronic rhinosinusit... -1.608 0.043
head and neck cancer -1.600 0.020

Gene RIF (3)

PMID Text
23285163 EGFL6 was overexpressed in benign meningioma tissues and serum.
20574786 results indicate that human EGFL6 is a paracrine/autocrine growth factor of adipose tissue up-regulated in obesity and potentially involved in the process of adipose tissue expansion and the development of obesity
18038328 There is an absence of GNAS and EGFL6 mutations in common human cancers.

AA Sequence

MPLPWSLALPLLLSWVAGGFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGVCEATCEPGCK      1 - 70
FGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFCLSGHMLMPDATCVNSRTCAM     71 - 140
INCQYSCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQY    141 - 210
ISGRYDCIDINECTMDSHTCSHHANCFNTQGSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRI    211 - 280
KKLLAHKNSMKKKAKIKNVTPEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREE    281 - 350
KALKNDIEERSLRGDVFFPKVNEAGEFGLILVQRKALTSKLEHKDLNISVDCSFNHGICDWKQDREDDFD    351 - 420
WNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALA    421 - 490
WEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPDSLLSVDD           491 - 553
//

Text Mined References (15)

PMID Year Title
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
23285163 2012 Analysis of gene expression profiling in meningioma: deregulated signaling pathways associated with meningioma and EGFL6 overexpression in benign meningioma tissue and serum.
20574786 2010 EGFL6 is increasingly expressed in human obesity and promotes proliferation of adipose tissue-derived stromal vascular cells.
18038328 2008 Absence of GNAS and EGFL6 mutations in common human cancers.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...