Property Summary

NCBI Gene PubMed Count 97
PubMed Score 90.71
PubTator Score 93.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 1.9e-03
atypical teratoid / rhabdoid tumor -1.100 7.8e-03
cutaneous lupus erythematosus 1.400 6.1e-03
group 4 medulloblastoma -1.100 9.7e-03
malignant mesothelioma -2.600 2.0e-07
medulloblastoma, large-cell -1.400 1.4e-04
osteosarcoma -1.660 2.1e-07

Gene RIF (186)

AA Sequence

MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCF      1 - 70
LSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQA     71 - 140
GARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKA    141 - 210
YGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPC    211 - 280
PECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEP    281 - 350
FKPWKGLKYNFLFLDSKLQEILE                                                   351 - 373
//

Text Mined References (105)

PMID Year Title