Property Summary

NCBI Gene PubMed Count 92
Grant Count 134
R01 Count 57
Funding $19,250,782.84
PubMed Score 88.83
PubTator Score 93.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
cutaneous lupus erythematosus 1.400 0.006
osteosarcoma -1.660 0.000
atypical teratoid / rhabdoid tumor -1.100 0.008
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.300 0.002
group 4 medulloblastoma -1.100 0.010

Synonym

Accession Q8IUX4 B0QYD4 Q45F03 Q6ICH3 Q7Z2N2 Q7Z2N5
Symbols A3F
KA6
ARP8
BK150C2.4.MRNA

Gene

PANTHER Protein Class (2)

PDB

3WUS   4IOU   4J4J   5HX4   5HX5  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
602313 confirmatory 765 / 10881 / 375193 qHTS for Inhibitors of Vif-A3F Interactions: qHTS
602324 summary 0 / 0 / 0 qHTS for inhibitors of Vif-A3F interactions: Summary
651814 confirmatory 590 / 877 / 627 qHTS for inhibitors of Vif-A3F interactions: Cherry picks
651815 confirmatory 1098 / 605 / 391 qHTS for inhibitors of Vif-A3F interactions: Cherry picks counterscreen

Gene RIF (344)

PMID Text
26942578 Our results provide genetic epidemiological evidence that A3F(APOBEC3F ) modulates HIV-1/AIDS disease progression
26760979 Overexpression of APOBEC3F in tumor tissues is potentially predictive for poor recurrence-free survival from hepatitis b virus-hepatocellular carcinoma patients.
26537685 Six residues located within the conserved HIV-1 Vif F1-, F2-, and F3-box motifs are essential for both APOBEC3C and APOBEC3F degradation, and an additional four residues are uniquely required for APOBEC3F degradation.
26482266 Findings support a role for APOBEC3G/F proteins in the generation of plasma drug-resistant minority human immunodeficiency virus type 1 variants (DRMVs). However, this role seems to be limited to a small subset of mutations and does not explain most of the DRMVs evaluated.
26055363 HIV-1 Env gp120 variable loop 3 (V3) region mutation is increased by incomplete Vif neutralization (Vif K22E) of APOBEC3G/F activity and may contribute to genetic evolution from CCR5 to CXCR4 co-receptor usage
26048885 APOBEC3G is more efficient at mutating retroviral DNA than APOBEC3F.
26016442 A3G and A3F inhibit porcine endogenous retrovirus replication.
25985400 This study showed for the first time a high level of APOBEC3F/3G editing in HIV-2 sequences from antiretroviral-naive patients.
25827531 HIV-1 Env gp120 variable loop 3 (V3) region mutation is increased by incomplete Vif neutralization (Vif K22E) of APOBEC3G/F activity and may contribute to genetic evolution from CCR5 to CXCR4 co-receptor usage
25807049 HIV-1 Env gp120 variable loop 3 (V3) region mutation is increased by incomplete Vif neutralization (Vif K22E) of APOBEC3G/F activity and may contribute to genetic evolution from CCR5 to CXCR4 co-receptor usage
More...

AA Sequence

MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCF      1 - 70
LSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQA     71 - 140
GARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKA    141 - 210
YGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPC    211 - 280
PECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEP    281 - 350
FKPWKGLKYNFLFLDSKLQEILE                                                   351 - 373
//

Text Mined References (100)

PMID Year Title
26942578 2016 Role of APOBEC3F Gene Variation in HIV-1 Disease Progression and Pneumocystis Pneumonia.
26760979 2015 Overexpression of APOBEC3F in tumor tissues is potentially predictive for poor recurrence-free survival from HBV-related hepatocellular carcinoma.
26537685 2015 Structural Insights into HIV-1 Vif-APOBEC3F Interaction.
26482266 2016 Contribution of APOBEC3G/F activity to the development of low-abundance drug-resistant human immunodeficiency virus type 1 variants.
26048885 2015 Comparative analysis of the gene-inactivating potential of retroviral restriction factors APOBEC3F and APOBEC3G.
26016442 2015 Differential sensitivity of porcine endogenous retrovirus to APOBEC3-mediated inhibition.
25985400 2015 High level of APOBEC3F/3G editing in HIV-2 DNA vif and pol sequences from antiretroviral-naive patients.
25590131 2015 Promiscuous RNA binding ensures effective encapsidation of APOBEC3 proteins by HIV-1.
25505075 2015 Genetic analysis of the localization of APOBEC3F to human immunodeficiency virus type 1 virion cores.
25330146 2014 APOBEC3D and APOBEC3F potently promote HIV-1 diversification and evolution in humanized mouse model.
More...