Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.38
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
medulloblastoma, large-cell 6234 4.77860151849554E-6
ovarian cancer 8492 5.15704667976808E-6
Pick disease 1893 1.1255707897519E-4
osteosarcoma 7933 4.70103722371427E-4
psoriasis 6685 0.00150162867132458
Multiple myeloma 1328 0.00209808309969596
hereditary spastic paraplegia 313 0.00215806678655677
progressive supranuclear palsy 674 0.00879890759336279
primary Sjogren syndrome 789 0.0159519970221111
astrocytoma 1493 0.0337708685097186
Alzheimer's disease 644 0.0373753690739718
acute myeloid leukemia 785 0.0438202195422136
Disease Target Count
Mitochondrial Complex 1 Deficiency 28

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.438 0.002
psoriasis 1.100 0.002
osteosarcoma 1.124 0.000
astrocytoma -1.100 0.034
medulloblastoma, large-cell -1.300 0.000
hereditary spastic paraplegia -1.186 0.002
primary Sjogren syndrome 1.200 0.016
Alzheimer's disease -1.100 0.037
Pick disease -1.200 0.000
progressive supranuclear palsy -1.100 0.009
acute myeloid leukemia -1.500 0.044
ovarian cancer -1.600 0.000

Synonym

Accession Q8IUX1 A8K535 A8MSS0 Q32Q09 Q8WVU3 Q96EP3 Q9NZ29
Symbols HT007

Gene

  Ortholog (8)

AA Sequence

MVVFGYEAGTKPRDSGVVPVGTEEAPKVFKMAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQ      1 - 70
NIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENC     71 - 140
VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGIL    141 - 210
NGLYHYAVFEETLEKTIHEE                                                      211 - 230
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24191001 2013 Assembly factors for the membrane arm of human complex I.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22982022 2012 Complexome profiling identifies TMEM126B as a component of the mitochondrial complex I assembly complex.
19570815 2009 A genome-wide association study of northwestern Europeans involves the C-type natriuretic peptide signaling pathway in the etiology of human height variation.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...