Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.54
PubTator Score 1.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.500 4.4e-02
Alzheimer's disease -1.100 3.7e-02
astrocytoma -1.100 3.4e-02
hereditary spastic paraplegia -1.186 2.2e-03
medulloblastoma, large-cell -1.300 4.8e-06
Multiple myeloma 1.438 2.1e-03
osteosarcoma 1.124 4.7e-04
ovarian cancer -1.600 5.2e-06
Pick disease -1.200 1.1e-04
primary Sjogren syndrome 1.200 1.6e-02
progressive supranuclear palsy -1.100 8.8e-03
psoriasis 1.100 1.5e-03

Gene RIF (2)

AA Sequence

MVVFGYEAGTKPRDSGVVPVGTEEAPKVFKMAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQ      1 - 70
NIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENC     71 - 140
VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGIL    141 - 210
NGLYHYAVFEETLEKTIHEE                                                      211 - 230
//

Text Mined References (18)

PMID Year Title