Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.69
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 2.4e-12
acute myeloid leukemia 783 3.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.200 3.0e-02
lung carcinoma -1.100 2.4e-12

Gene RIF (3)

AA Sequence

MAPRALPGSAVLAAAVFVGGAVSSPLVAPDNGSSRTLHSRTETTPSPSNDTGNGHPEYIAYALVPVFFIM      1 - 70
GLFGVLICHLLKKKGYRCTTEAEQDIEEEKVEKIELNDSVNENSDTVGQIVHYIMKNEANADVLKAMVAD     71 - 140
NSLYDPESPVTPSTPGSPPVSPGPLSPGGTPGKHVCGHHLHTVGGVVERDVCHRCRHKRWHFIKPTNKSR    141 - 210
ESRPRRQGEVTVLSVGRFRVTKVEHKSNQKERRSLMSVSGAETVNGEVPATPVKRERSGTE             211 - 271
//

Text Mined References (12)

PMID Year Title