Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 3.3e-03
breast carcinoma 1.500 2.4e-03
ependymoma -1.100 4.7e-06
group 3 medulloblastoma -1.200 1.9e-02
medulloblastoma, large-cell -1.700 1.2e-03
osteosarcoma -1.240 2.2e-04
ovarian cancer 1.900 6.2e-05

Synonym

Accession Q8IUW3 D3DX85 Q8NHV3 SPATA2-like protein
Symbols tamo
C16orf76

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGSSSLSEDYRQCLERELRRGRAGVCGDPSLRAVLWQILVEDFDLHGALQDDALALLTDGLWGRADLAPA      1 - 70
LRGLARAFELLELAAVHLYLLPWRKEFTTIKTFSGGYVHVLKGVLSDDLLLKSFQKMGYVRRDSHRLMVT     71 - 140
ALPPACQLVQVALGCFALRLECEILGEVLAQLGTSVLPAEELLQARRASGDVASCVAWLQQRLAQDEEPP    141 - 210
PLPPRGSPAAYRAPLDLYRDLQEDEGSEDASLYGEPSPGPDSPPAELAYRPPLWEQSAKLWGTGGRAWEP    211 - 280
PAEELPQASSPPYGALEEGLEPEPSAFSFLSLRRELSRPGDLATPESSAAASPRRIRAEGVPASAYRSVS    281 - 350
EPPGYQAHSCLSPGALPTLCCDTCRQLHAAHCAALPACRPGHSLRVLLGDAQRRLWLQRAQMDTLLYNSP    351 - 420
GARP                                                                      421 - 424
//

Text Mined References (5)

PMID Year Title