Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
R01 Count 4
Funding $187,089.28
PubMed Score 4.27
PubTator Score 11.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.900 0.001
ependymoma -3.100 0.001
oligodendroglioma -2.400 0.007
glioblastoma -2.600 0.000
medulloblastoma -3.300 0.000
cystic fibrosis 1.553 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.500 0.002
primitive neuroectodermal tumor -3.100 0.000
active ulcerative colitis 1.128 0.041
pancreatic cancer 1.300 0.000
adult high grade glioma -2.000 0.029
ovarian cancer 2.500 0.000
psoriasis -1.100 0.000

Gene RIF (3)

PMID Text
22798687 The identification of two human epoxide hydrolases: EH3 and EH4.
20723587 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARLRDCLPRLMLTLRSLLFWSLVYCYCGLCASIHLLKLLWSLGKGPAQTFRRPAREHPPACLSDPSLGT      1 - 70
HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEYRVVALDLRGYGETDAPIHRQ     71 - 140
NYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQ    141 - 210
LLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVFSQPGALSGPINH    211 - 280
YRNIFSCLPLKHHMVTTPTLLLWGENDAFMEVEMAEVTKIYVKNYFRLTILSEASHWLQQDQPDIVNKLI    281 - 350
WTFLKEETRKKD                                                              351 - 362
//

Text Mined References (7)

PMID Year Title
22798687 2012 EH3 (ABHD9): the first member of a new epoxide hydrolase family with high activity for fatty acid epoxides.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.