Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.27
PubTator Score 11.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.44930092769992E-19
medulloblastoma 1524 2.49720153019352E-6
atypical teratoid / rhabdoid tumor 4369 2.69371838060396E-6
pancreatic cancer 2300 6.4891443073635E-6
ovarian cancer 8492 2.69402119621008E-5
cystic fibrosis 1670 8.69180157064464E-5
glioblastoma 5572 3.41991803459623E-4
primitive neuroectodermal tumor 3031 3.91171690178217E-4
ependymoma 2514 9.991391219439E-4
astrocytic glioma 2241 0.00121851799475587
medulloblastoma, large-cell 6234 0.00182281977264189
oligodendroglioma 2849 0.00650237665408683
adult high grade glioma 2148 0.0288745365533687
active ulcerative colitis 477 0.0406348849167106
Disease Target Count Z-score Confidence
Pseudomyxoma peritonei 6 4.074 2.0
Syphilis 18 3.081 1.5

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.900 0.001
ependymoma -3.100 0.001
oligodendroglioma -2.400 0.007
glioblastoma -2.600 0.000
medulloblastoma -3.300 0.000
cystic fibrosis 1.553 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.500 0.002
primitive neuroectodermal tumor -3.100 0.000
active ulcerative colitis 1.128 0.041
pancreatic cancer 1.300 0.000
adult high grade glioma -2.000 0.029
ovarian cancer 2.500 0.000
psoriasis -1.100 0.000

Synonym

Accession Q8IUS5 Q8NCC6
Symbols EH4
ABHD7
EPHXRP

Gene

PANTHER Protein Class (3)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (3)

PMID Text
22798687 The identification of two human epoxide hydrolases: EH3 and EH4.
20723587 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARLRDCLPRLMLTLRSLLFWSLVYCYCGLCASIHLLKLLWSLGKGPAQTFRRPAREHPPACLSDPSLGT      1 - 70
HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEYRVVALDLRGYGETDAPIHRQ     71 - 140
NYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQ    141 - 210
LLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVFSQPGALSGPINH    211 - 280
YRNIFSCLPLKHHMVTTPTLLLWGENDAFMEVEMAEVTKIYVKNYFRLTILSEASHWLQQDQPDIVNKLI    281 - 350
WTFLKEETRKKD                                                              351 - 362
//

Text Mined References (7)

PMID Year Title
22798687 2012 EH3 (ABHD9): the first member of a new epoxide hydrolase family with high activity for fatty acid epoxides.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.