Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.54
PubTator Score 7.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 2.04524773111593E-14
Amyotrophic Lateral Sclerosis 432 1.05053161161432E-8
osteosarcoma 7933 1.26932322715831E-6
acute quadriplegic myopathy 1157 2.19983892119184E-6
ovarian cancer 8492 5.44448971096239E-6
atypical teratoid / rhabdoid tumor 4369 1.58092928163842E-5
tuberculosis and treatment for 6 months 686 3.35208960470647E-5
medulloblastoma, large-cell 6234 1.98191225714496E-4
psoriasis 6685 4.13970964554759E-4
group 4 medulloblastoma 1875 0.00102634884882064
Pick disease 1893 0.00156982824369185
adult high grade glioma 2148 0.00330546786864438
glioblastoma 5572 0.00622243838739168
Rheumatoid Arthritis 1171 0.026407230858567
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0367601179188667
astrocytic glioma 2241 0.0378471089136797
subependymal giant cell astrocytoma 2287 0.0465296608845088
Disease Target Count Z-score Confidence
Intraductal papilloma 3 3.671 1.8
Lissencephaly 61 3.317 1.7

Expression

  Differential Expression (17)

Synonym

Accession Q8IUR7 A8K0L2 B7Z441 B7Z453 D3DNE6 F5GWK4 Q6PIL2 Q96D19 Q96HZ5 Q9NV02 Q9NV94 Q9Y4R9
Symbols GID5
VID28
S863-2
HSPC056

Gene

  Ortholog (8)

Gene RIF (5)

PMID Text
26232863 ARMc8 may enhance the invasion and metastasis of ovarian cancer cells
26081621 invasiveness and migration capacity of HT29 cells transfected with ARMc8 were significantly greater than those of control cells (p < 0.001), while ARMc8 siRNA treatment significantly reduced cell invasion and migration in LoVo cells
25119601 Armc8 expression was elevated during atypia-to-carcinoma progression and associated with cancer development of breast carcinoma.
24894675 Data suggest that armadillo repeat containing protein 8 (ARMC8) might serve as a therapeutic target in non-small cell lung cancer (NSCLC).
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells

AA Sequence

MACLLETPIRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLL      1 - 70
QQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPE     71 - 140
ELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALK    141 - 210
CFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKT    211 - 280
LPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHD    281 - 350
LKHAHELRQAAFKLYASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRT    351 - 420
SFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIW    421 - 490
ALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAV    491 - 560
TLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEE    561 - 630
EGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKMALQQYLA                               631 - 673
//

Text Mined References (15)

PMID Year Title
26232863 2015 A novel biomarker ARMc8 promotes the malignant progression of ovarian cancer.
26081621 2015 ARMc8 indicates aggressive colon cancers and promotes invasiveness and migration of colon cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25119601 2014 Armc8 expression was elevated during atypia-to-carcinoma progression and associated with cancer development of breast carcinoma.
24894675 2014 ARMC8? promotes proliferation and invasion of non-small cell lung cancer cells by activating the canonical Wnt signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17467196 2007 RanBPM, Muskelin, p48EMLP, p44CTLH, and the armadillo-repeat proteins ARMC8alpha and ARMC8beta are components of the CTLH complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...