Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.58
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.255 2.2e-06
adult high grade glioma -1.300 3.3e-03
Amyotrophic lateral sclerosis 1.150 1.1e-08
astrocytic glioma -1.800 3.8e-02
atypical teratoid / rhabdoid tumor -1.700 1.6e-05
Breast cancer -1.500 2.0e-14
glioblastoma -1.200 6.2e-03
group 3 medulloblastoma 1.100 2.1e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.7e-02
medulloblastoma, large-cell -1.800 2.0e-04
osteosarcoma -2.989 1.9e-06
ovarian cancer -1.100 1.6e-05
Pick disease -1.100 1.6e-03
psoriasis -1.600 4.1e-04
Rheumatoid arthritis 1.200 2.6e-02
subependymal giant cell astrocytoma -1.142 4.7e-02
tuberculosis and treatment for 6 months 1.500 3.4e-05

Gene RIF (7)

AA Sequence

MACLLETPIRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLL      1 - 70
QQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPE     71 - 140
ELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALK    141 - 210
CFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKT    211 - 280
LPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHD    281 - 350
LKHAHELRQAAFKLYASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRT    351 - 420
SFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIW    421 - 490
ALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAV    491 - 560
TLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEE    561 - 630
EGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKMALQQYLA                               631 - 673
//

Text Mined References (17)

PMID Year Title