Property Summary

NCBI Gene PubMed Count 10
Grant Count 9
R01 Count 9
Funding $1,627,876.67
PubMed Score 14.54
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (5)

PMID Text
26232863 ARMc8 may enhance the invasion and metastasis of ovarian cancer cells
26081621 invasiveness and migration capacity of HT29 cells transfected with ARMc8 were significantly greater than those of control cells (p < 0.001), while ARMc8 siRNA treatment significantly reduced cell invasion and migration in LoVo cells
25119601 Armc8 expression was elevated during atypia-to-carcinoma progression and associated with cancer development of breast carcinoma.
24894675 Data suggest that armadillo repeat containing protein 8 (ARMC8) might serve as a therapeutic target in non-small cell lung cancer (NSCLC).
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells

AA Sequence

MACLLETPIRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLL      1 - 70
QQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPE     71 - 140
ELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALK    141 - 210
CFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKT    211 - 280
LPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHD    281 - 350
LKHAHELRQAAFKLYASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAVRCLHSLSRSVQQLRT    351 - 420
SFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIW    421 - 490
ALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAV    491 - 560
TLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEE    561 - 630
EGSQERQDKLRDMGIVDILHKLSQSPDSNLCDKAKMALQQYLA                               631 - 673
//

Text Mined References (15)

PMID Year Title
26232863 2015 A novel biomarker ARMc8 promotes the malignant progression of ovarian cancer.
26081621 2015 ARMc8 indicates aggressive colon cancers and promotes invasiveness and migration of colon cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25119601 2014 Armc8 expression was elevated during atypia-to-carcinoma progression and associated with cancer development of breast carcinoma.
24894675 2014 ARMC8? promotes proliferation and invasion of non-small cell lung cancer cells by activating the canonical Wnt signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17467196 2007 RanBPM, Muskelin, p48EMLP, p44CTLH, and the armadillo-repeat proteins ARMC8alpha and ARMC8beta are components of the CTLH complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...