Property Summary

NCBI Gene PubMed Count 103
Grant Count 45
R01 Count 20
Funding $4,677,035.05
PubMed Score 77.88
PubTator Score 89.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (63)

PMID Text
26722480 In neuroblastoma cells, siRNA silencing of SIAH1 promoted cellular proliferation and suppressed apoptosis. Protein and mRNA expression of alpha-synuclein, LC3-II and p53 decreased after SIAH1 knockdown. E1 protein and mRNA levels increased after SIAH1 siRNA.
26654769 SIAH1 is associated with a tumor promoting role in breast cancer.
26438826 findings demonstrate that dissociation of the GAPDH/Siah1 pro-apoptotic complex can block high glucose-induced pericyte apoptosis, widely considered a hallmark feature of DR
26267146 Similar to TAp73, DNp73 is stabilized by hypoxia in a HIF-1a-dependent manner, which otherwise is degraded by Siah1.
26069251 miRNA network regulates SIAH1 in in colorectal metastasis tissues.
25851994 Results demonstrated that miR-107 directly down-regulated SIAH1 expression in human breast cancer cells. An inverse correlation between the expression of miR-107 and SIAH1 was found in human breast cancer tissues and cell lines.
25728284 CDK2 up-regulates the protein level of KLF10 through reducing its association with SIAH1, a KLF10 E3-ubiqutin ligase involved in proteasomal degradation.
25528765 Data indicate that ubiquitin ligase Siah as a regulator of to Mesenchymal Transition (EMT) by controlling the abundance of the key transcription factor Zeb1, while Siah itself is subject to regulation by EMT-inducing factors.
25391652 Siah1 is a substrate of ASK1 for activation of the GAPDH-Siah1 oxidative stress signaling cascade.
25202994 molecular basis of Siah1 and Siah2 E3 ubiquitin ligase substrate specificity
More...

AA Sequence

MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLT      1 - 70
CCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGS     71 - 140
LDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQ    141 - 210
LIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTIS    211 - 280
MC                                                                        281 - 282
//

Text Mined References (106)

PMID Year Title
26722480 2015 Silencing of SIAH1 in SH-SY5Y affects ?-synuclein degradation pathway.
26654769 2015 SIAH ubiquitin ligases regulate breast cancer cell migration and invasion independent of the oxygen status.
26438826 2015 High Glucose-induced Retinal Pericyte Apoptosis Depends on Association of GAPDH and Siah1.
26267146 2015 Hypoxia-induced DNp73 stabilization regulates Vegf-A expression and tumor angiogenesis similar to TAp73.
26069251 2015 A Systematic Approach to Defining the microRNA Landscape in Metastasis.
25851994 2016 MiR-107 down-regulates SIAH1 expression in human breast cancer cells and silencing of miR-107 inhibits tumor growth in a nude mouse model of triple-negative breast cancer.
25728284 2015 CDK2 phosphorylation regulates the protein stability of KLF10 by interfering with binding of the E3 ligase SIAH1.
25528765 2015 The ubiquitin ligase Siah is a novel regulator of Zeb1 in breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25391652 2015 Role of apoptosis signal-regulating kinase 1 (ASK1) as an activator of the GAPDH-Siah1 stress-signaling cascade.
More...