Property Summary

NCBI Gene PubMed Count 112
PubMed Score 82.98
PubTator Score 89.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.4e-04
group 3 medulloblastoma 1.200 1.6e-02
medulloblastoma, large-cell 1.500 4.9e-04
osteosarcoma 1.828 1.4e-03
ovarian cancer -1.100 4.6e-04
primitive neuroectodermal tumor 1.500 2.1e-05
tuberculosis and treatment for 6 months 1.300 4.4e-05

Protein-protein Interaction (5)

Gene RIF (71)

AA Sequence

MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLT      1 - 70
CCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGS     71 - 140
LDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQ    141 - 210
LIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTIS    211 - 280
MC                                                                        281 - 282
//

Text Mined References (115)

PMID Year Title