Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.43
PubTator Score 3.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 6.7e-07
atypical teratoid / rhabdoid tumor -1.900 2.6e-09
ependymoma -1.200 4.0e-10
glioblastoma -1.300 1.5e-06
lung carcinoma 1.600 2.1e-19
pediatric high grade glioma -1.300 1.4e-04
primitive neuroectodermal tumor -1.100 2.5e-02

Synonym

Accession Q8IUQ0 B2R7M5 C8UZT3 Q8NB32
Symbols CRALBPL
RLBP1L1
C6orf212L

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

Gene RIF (3)

AA Sequence

MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLR      1 - 70
TDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKI     71 - 140
LLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQ    141 - 210
DSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDM    211 - 280
GTWARTLLGPDYSDENDYTHTSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPL    281 - 350
LALD                                                                      351 - 354
//

Text Mined References (12)

PMID Year Title