Property Summary

NCBI Gene PubMed Count 15
PubMed Score 111.81
PubTator Score 159.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count
Bipolar Disorder 666

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.100 4.2e-02
intraductal papillary-mucinous carcinoma... -1.100 2.8e-03
non-small cell lung cancer -1.368 2.3e-16
ovarian cancer -1.800 3.4e-09
tuberculosis 1.600 3.2e-04

Gene RIF (10)

AA Sequence

MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLV      1 - 70
TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPS     71 - 140
VCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQ    141 - 210
LKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGE    211 - 280
DCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH                                      281 - 316
//

Text Mined References (16)

PMID Year Title