Property Summary

NCBI Gene PubMed Count 14
PubMed Score 104.65
PubTator Score 159.83

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Myocardial Ischemia 169
Disease Target Count P-value
non-small cell lung cancer 2798 2.25754899771619E-16
ovarian cancer 8492 3.41983081819655E-9
tuberculosis and treatment for 3 months 327 3.15014136449221E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00279979842494907
interstitial cystitis 2299 0.0418146612144123


  Differential Expression (5)


Accession Q8IUN9 A8K8J8 Q14538 Q6PIW3
Symbols HML


  Ortholog (3)

Species Source
Chimp OMA EggNOG Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (9)

26172302 BRAF(V600E) mutation induces MGL ligand expression, thereby providing a direct link between oncogenic transformation and aberrant expression of immunosuppressive glycans in colorectal neoplasms.
26147970 These results indicate a role of MGL as an immunomodulator within the tumour microenvironment interfering with Treg functions, suggesting its possible use in the design of anticancer vaccines.
23918927 expression of GalNAc moieties mirrors the T cell activation status, and thus only highly stimulated T cells are prone to the suppressive action of MGL.
23744646 MGL triggering synergized with TLR2-induced pathways, leading to elevated IL-10 mRNA levels & enhanced TNF-alpha mRNA stability. It promoted phosphorylation of the ERK & CREB, fine-tuning the DC maturation phenotype.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of C-type lectin domain family 10, member A (CLEC10A) in peptide-treated PBMCs
23275449 Described is the use of recombinant CLEC10A (CD301), a human glycoreceptor of the C-type lectin family, for the detection of ligands in sections from formalin-fixed, paraffin-embedded normal and cancerous mammary tissues.
22531918 MGL engagement improved DC performance as antigen-presenting cells, promoting the upregulation of maturation markers, a decrease in phagocytosis, an enhancement of motility, and most importantly an increase in antigen-specific CD8(+) T-cell activation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19776380 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

DCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH                                      281 - 316

Text Mined References (15)

PMID Year Title
26172302 2015 MGL ligand expression is correlated to BRAF mutation and associated with poor survival of stage III colon cancer patients.
26147970 2015 The Macrophage Galactose-Type C-Type Lectin (MGL) Modulates Regulatory T Cell Functions.
23918927 2013 Human T cell activation results in extracellular signal-regulated kinase (ERK)-calcineurin-dependent exposure of Tn antigen on the cell surface and binding of the macrophage galactose-type lectin (MGL).
23744646 2013 MGL signaling augments TLR2-mediated responses for enhanced IL-10 and TNF-? secretion.
23275449 2013 Protein domain histochemistry (PDH): binding of the carbohydrate recognition domain (CRD) of recombinant human glycoreceptor CLEC10A (CD301) to formalin-fixed, paraffin-embedded breast cancer tissues.
22531918 2012 Targeting of macrophage galactose-type C-type lectin (MGL) induces DC signaling and activation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19834553 2009 Variation of Neisseria gonorrhoeae lipooligosaccharide directs dendritic cell-induced T helper responses.
19776380 2009 Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.