Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.33
PubTator Score 3.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 0.003
posterior fossa group A ependymoma -3.400 0.000
oligodendroglioma -2.400 0.008
glioblastoma -2.900 0.000
osteosarcoma -1.885 0.017
group 4 medulloblastoma -2.700 0.002
medulloblastoma, large-cell -2.400 0.030
interstitial cystitis -1.500 0.004
adult high grade glioma -3.300 0.001
pilocytic astrocytoma -2.700 0.000
Pick disease -1.600 0.012
Breast cancer 1.300 0.030
ovarian cancer -1.400 0.000

Gene RIF (2)

PMID Text
23502781 Single nucleotide polymorphisms in CBLN2 gene is associated with pulmonary arterial hypertension.
22117778 Transgenic Cbln2 can exhibit functional redundancy with Cbln1 in the cerebellum, but it does not have the same properties as Cbln1 in thalamic neurons.

AA Sequence

MQAPGRGPLGLRLMMPGRRGALREPGGCGSCLGVALALLLLLLPACCPVRAQNDTEPIVLEGKCLVVCDS      1 - 70
SPSADGAVTSSLGISVRSGSAKVAFSATRSTNHEPSEMSNRTMTIYFDQVLVNIGNHFDLASSIFVAPRK     71 - 140
GIYSFSFHVVKVYNRQTIQVSLMQNGYPVISAFAGDQDVTREAASNGVLLLMEREDKVHLKLERGNLMGG    141 - 210
WKYSTFSGFLVFPL                                                            211 - 224
//

Text Mined References (9)

PMID Year Title
23502781 2013 Genome-wide association analysis identifies a susceptibility locus for pulmonary arterial hypertension.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
22117778 2012 Comparison of Cbln1 and Cbln2 functions using transgenic and knockout mice.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7877445 1994 Genomic structure and mapping of precerebellin and a precerebellin-related gene.