Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.77
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.300 5.7e-04
astrocytic glioma -2.500 3.1e-03
Astrocytoma, Pilocytic -2.700 1.8e-04
Breast cancer 1.300 3.0e-02
ependymoma -3.100 1.0e-03
glioblastoma -2.900 2.1e-06
group 4 medulloblastoma -2.700 2.3e-03
interstitial cystitis -1.500 3.9e-03
medulloblastoma, large-cell -2.400 3.0e-02
oligodendroglioma -2.400 8.1e-03
osteosarcoma -1.885 1.7e-02
ovarian cancer -1.400 5.9e-09
Pick disease -1.600 1.2e-02

Gene RIF (2)

AA Sequence

MQAPGRGPLGLRLMMPGRRGALREPGGCGSCLGVALALLLLLLPACCPVRAQNDTEPIVLEGKCLVVCDS      1 - 70
SPSADGAVTSSLGISVRSGSAKVAFSATRSTNHEPSEMSNRTMTIYFDQVLVNIGNHFDLASSIFVAPRK     71 - 140
GIYSFSFHVVKVYNRQTIQVSLMQNGYPVISAFAGDQDVTREAASNGVLLLMEREDKVHLKLERGNLMGG    141 - 210
WKYSTFSGFLVFPL                                                            211 - 224
//

Text Mined References (9)

PMID Year Title