Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
Funding $967,524.07
PubMed Score 80.10
PubTator Score 20.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26093087 Immunohistochemical analysis of 122 gliomas showed that TGLI1 expression was positively correlated with VEGF-C, TEM7 and microvessel density.
25535841 PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
21958527 TEM-7 is a vascular protein associated with angiogenic states. TEM-7 is a novel and attractive target for antiangiogenic therapy.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20032373 All osteosarcoma cell lines, 6/9 tumors but none of the bone specimens expressed mRNA of TEM7 secreted forms 1 and 2.
18316703 TEM7 may play significant role in proliferation and maintenance of neovascular endothelial cells in fibrovascular membranes. TEM7 may be molecular target for new diagnostic and therapeutic strategies for proliferative diabetic retinopathy.
17560052 TEM7 expression level closely parallels histology-based prognostication of OGS metastasis and, therefore, it is a therapeutic target.

AA Sequence

MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQLSQDLGGG      1 - 70
TLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHTILSNTHRQASRVVLSFD     71 - 140
FPFYGHPLRQITIATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVYL    141 - 210
QGWEDKGSFTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPDVPESRRRSIFEY    211 - 280
HRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQE    281 - 350
AEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGT    351 - 420
PVHLGTIVGIVLAVLLVAAIILAGIYINGHPTSNAALFFIERRPHHWPAMKFRSHPDHSTYAEVEPSGHE    421 - 490
KEGFMEAEQC                                                                491 - 500
//

Text Mined References (18)

PMID Year Title
26093087 2015 The gain-of-function GLI1 transcription factor TGLI1 enhances expression of VEGF-C and TEM7 to promote glioblastoma angiogenesis.
25535841 2014 Identification of PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
21958527 2011 Tumor endothelial marker 7 (TEM-7): a novel target for antiangiogenic therapy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20032373 2009 Preferential expression of the secreted and membrane forms of tumor endothelial marker 7 transcripts in osteosarcoma.
18316703 2008 TEM7 (PLXDC1) in neovascular endothelial cells of fibrovascular membranes from patients with proliferative diabetic retinopathy.
17560052 2007 High expression of tumor endothelial marker 7 is associated with metastasis and poor survival of patients with osteogenic sarcoma.
16574105 2006 Identification of the basement membrane protein nidogen as a candidate ligand for tumor endothelial marker 7 in vitro and in vivo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...