Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.37
PubTator Score 9.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.388 0.019
group 3 medulloblastoma 1.600 0.001
glioblastoma 1.100 0.005
diabetes mellitus -1.100 0.010
Breast cancer 2.200 0.042
primary Sjogren syndrome 1.800 0.000
ovarian cancer 1.100 0.008

Gene RIF (5)

PMID Text
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19427400 p48.2 may represent a novel type of intracellular protein functioning as a negative regulator at the G0/G1 phase.
19291764 Observational study of gene-disease association. (HuGE Navigator)
228748 Suggests that the homologous rat protein is involved in neuronal morphology regulation.

AA Sequence

MRGAMELEPELLLQEARENVEAAQSYRRELGHRLEGLREARRQIKESASQTRDVLKQHFNDLKGTLGKLL      1 - 70
DERLVTLLQEVDTIEQETIKPLDDCQKLIEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQL     71 - 140
DSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQD    141 - 210
YRLQFRKCTSNHFEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQIGHSTLVPHEWTAG    211 - 280
FEGYSLSSRRNIALRNDSESSGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQ    281 - 350
AVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGGHFKLRVTISSNNREVVFDWLLD    351 - 420
QSCGSLYFGCSFFYPGWKVLVF                                                    421 - 442
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22874834 2012 Uncovering genes required for neuronal morphology by morphology-based gene trap screening with a revertible retrovirus vector.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19427400 2009 Cloning and characterization of a novel intracellular protein p48.2 that negatively regulates cell cycle progression.
19291764 2009 RNF135 mutations are not present in patients with Sotos syndrome-like features.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...