Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.81
PubTator Score 9.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 2.200 4.2e-02
diabetes mellitus -1.100 1.0e-02
glioblastoma 1.100 4.9e-03
group 3 medulloblastoma 1.600 9.8e-04
ovarian cancer 1.100 7.6e-03
primary Sjogren syndrome 1.800 3.6e-04
Waldenstrons macroglobulinemia 1.388 1.9e-02

Synonym

Accession Q8IUI8 A6NJF3 B2R8C3 Q2MLY7 Q9UNI3 Q9Y6M8
Symbols FRWS
CRLM9
p48.2
CREME9
CYTOR4
CREME-9

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MRGAMELEPELLLQEARENVEAAQSYRRELGHRLEGLREARRQIKESASQTRDVLKQHFNDLKGTLGKLL      1 - 70
DERLVTLLQEVDTIEQETIKPLDDCQKLIEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQL     71 - 140
DSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQD    141 - 210
YRLQFRKCTSNHFEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQIGHSTLVPHEWTAG    211 - 280
FEGYSLSSRRNIALRNDSESSGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQ    281 - 350
AVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGGHFKLRVTISSNNREVVFDWLLD    351 - 420
QSCGSLYFGCSFFYPGWKVLVF                                                    421 - 442
//

Text Mined References (23)

PMID Year Title