Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $333,488.01
PubMed Score 0.74
PubTator Score 4.70

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q8IUH8 Q8TC67 Q8WVZ6 SPP-like 2C
Symbols IMP5

Gene

PANTHER Protein Class (3)

 GO Process (1)

Gene RIF (3)

PMID Text
16415175 Observational study of gene-disease association. (HuGE Navigator)
15385547 SPP, SPPL2a, -2b, -2c, and -3 probably cleave type II-oriented substrate peptides as shown by consensus analysis [SPPL2c]
15293277 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MACLGFLLPVGFLLLISTVAGGKYGVAHVVSENWSKDYCILFSSDYITLPRDLHHAPLLPLYDGTKAPWC      1 - 70
PGEDSPHQAQLRSPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLIVSRVSDQQCSDTTLAPQDPR     71 - 140
QPLADLTIPVAMLHYADMLDILSHTRGEAVVRVAMYAPPEPIIDYNMLVIFILAVGTVAAGGYWAGLTEA    141 - 210
NRLQRRRARRGGGSGGHHQLQEAAAAEGAQKEDNEDIPVDFTPAMTGVVVTLSCSLMLLLYFFYDHFVYV    211 - 280
TIGIFGLGAGIGLYSCLSPLVCRLSLRQYQRPPHSLWASLPLPLLLLASLCATVIIFWVAYRNEDRWAWL    281 - 350
LQDTLGISYCLFVLHRVRLPTLKNCSSFLLALLAFDVFFVFVTPFFTKTGESIMAQVALGPAESSSHERL    351 - 420
PMVLKVPRLRVSALTLCSQPFSILGFGDIVVPGFLVAYCCRFDVQVCSRQIYFVACTVAYAVGLLVTFMA    421 - 490
MVLMQMGQPALLYLVSSTLLTSLAVAACRQELSLFWTGQGRAKMCGLGCAPSAGSRQKQEGAADAHTAST    491 - 560
LERGTSRGAGDLDSNPGEDTTEIVTISENEATNPEDRSDSSEGWSDAHLDPNELPFIPPGASEELMPLMP    561 - 630
MAMLIPLMPLMPPPSELGHVHAQAQAHETGLPWAGLHKRKGLKVRKSMSTQAPL                    631 - 684
//

Text Mined References (12)

PMID Year Title
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
22693459 2012 Six novel susceptibility Loci for early-onset androgenetic alopecia and their unexpected association with common diseases.
21738487 2011 Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease.
17965014 2008 Regulated intramembrane proteolysis of Bri2 (Itm2b) by ADAM10 and SPPL2a/SPPL2b.
16829952 2006 SPPL2a and SPPL2b promote intramembrane proteolysis of TNFalpha in activated dendritic cells to trigger IL-12 production.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385547 2004 Consensus analysis of signal peptide peptidase and homologous human aspartic proteases reveals opposite topology of catalytic domains compared with presenilins.
15293277 2004 Novel haplotypes in 17q21 are associated with progressive supranuclear palsy.
More...