Property Summary

NCBI Gene PubMed Count 28
PubMed Score 31.12
PubTator Score 17.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Huntington's disease 76 5.075 2.5

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.200 1.6e-02
atypical teratoid / rhabdoid tumor -1.300 4.7e-04
ependymoma 1.700 3.5e-03
glioblastoma -1.200 5.6e-04
group 4 medulloblastoma 1.100 3.4e-03
medulloblastoma, large-cell -1.400 3.3e-05
oligodendroglioma 1.700 5.5e-03
osteosarcoma 1.320 1.1e-02
ovarian cancer -2.200 4.6e-08

Gene RIF (16)

AA Sequence

MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIY      1 - 70
ERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMV     71 - 140
VQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLL    141 - 210
LTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEA    211 - 280
RQAKGYDNPSFLRKLKADKEFRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFF    281 - 350
DHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK    351 - 420
KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLL    421 - 490
FMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAVLLMCQMYQISCLG    491 - 560
ITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQ    561 - 630
LV                                                                        631 - 632
//

Text Mined References (35)

PMID Year Title