Property Summary

NCBI Gene PubMed Count 26
Grant Count 11
R01 Count 9
Funding $2,378,115.5
PubMed Score 24.93
PubTator Score 17.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.200 0.016
ependymoma 1.700 0.004
oligodendroglioma 1.700 0.005
osteosarcoma 1.320 0.011
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.400 0.000
group 4 medulloblastoma 1.100 0.003
ovarian cancer -2.200 0.000

Gene RIF (14)

PMID Text
25849918 This suggests that altered HIP14-HTT and HIP14L-HTT interactions in the presence of the HD mutation reduces palmitoylation and promotes mislocalization of HTT and other HIP14/HIP14L substrates
24705354 HIP14 shares a high proportion of interactors with HTT resulting in defective palmitoylation of the target proteins which might be an important mechanism towards pathogenesis of Huntington's disease.
24651384 Data show that deletion of huntingtin protein (HTT) amino acids 1-427 abolishes the interaction of HTT with palmitoyl acyltransferases huntingtin interacting protein 14 (HIP14) and huntingtin interacting protein 14-like (HIP14L).
24001771 DHHC17 is a ClipR-59 palmitoyltransferase that modulates ClipR-59 plasma membrane binding.
22649491 Low levels of human HIP14 are sufficient to rescue neuropathological, behavioural, and enzymatic defects due to loss of murine HIP14 in Hip14-/- mice.
21849558 Novel peptides have been developed that target the jun N-terminus kinase (JNK)-interacting motif on zD17 to selectively block enhancement of the zD17-Jun N terminus kinase (JNK) interaction and the activation of JNK isoforms 2 and 3.
21705657 Immunohistochemical analysis of pancreatic sections demonstrated that HIP14 is almost exclusively expressed in insulin-positive cells in islets of Langerhans.
20507996 a subset of DHHCs controls STREX palmitoylation and function; DHHC17 may preferentially target cysteine-rich domains
19955568 Coexpression of an independent palmitoyl acyltransferase (HIP14) with the GODZ-DHHS mutant also rescued Ca(2+) transport.
19434754 The ankyrin repeat domain of Huntingtin interacting protein 14 contains a surface aromatic cage, a potential site for methyl-lysine binding.
More...

AA Sequence

MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIY      1 - 70
ERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMV     71 - 140
VQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLL    141 - 210
LTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEA    211 - 280
RQAKGYDNPSFLRKLKADKEFRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFF    281 - 350
DHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK    351 - 420
KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLL    421 - 490
FMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAVLLMCQMYQISCLG    491 - 560
ITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQ    561 - 630
LV                                                                        631 - 632
//

Text Mined References (32)

PMID Year Title
26198635 2015 Identification of a Novel Sequence Motif Recognized by the Ankyrin Repeat Domain of zDHHC17/13 S-Acyltransferases.
25849918 2015 Aberrant palmitoylation in Huntington disease.
25547411 2014 Identifying tandem Ankyrin repeats in protein structures.
25416956 2014 A proteome-scale map of the human interactome network.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24651384 2014 Identification of binding sites in Huntingtin for the Huntingtin Interacting Proteins HIP14 and HIP14L.
24001771 2013 DHHC17 palmitoylates ClipR-59 and modulates ClipR-59 association with the plasma membrane.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22649491 2012 Low levels of human HIP14 are sufficient to rescue neuropathological, behavioural, and enzymatic defects due to loss of murine HIP14 in Hip14-/- mice.
More...