Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.42
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Alopecia 55
Amyloidosis 68
Osteoporosis 259
Disease Target Count P-value
lung carcinoma 2844 3.05119153894285E-15
lung adenocarcinoma 2714 3.68486070550866E-7
ovarian cancer 8492 2.12592484492478E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.91613682286504E-5
adrenocortical carcinoma 1427 7.64804203557732E-5
osteosarcoma 7933 1.39833325275863E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.02103444297293E-4
medulloblastoma, large-cell 6234 3.1669545506224E-4
lung cancer 4473 3.5380931944889E-4
psoriasis 6685 9.77609933303122E-4
adult high grade glioma 2148 0.00286182100455933
invasive ductal carcinoma 2950 0.00358000581994096
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00610910066949339
ductal carcinoma in situ 1745 0.00707994680770943
astrocytic glioma 2241 0.0428318249602858
Disease Target Count Z-score Confidence
Huntington's disease 72 4.046 2.0

Expression

Synonym

Accession Q8IUH4 Q7Z2D3 Q86VK2 Q9NV30 Q9NV99
Symbols HIP14L
HIP3RP

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (3)

PMID Text
25849918 This suggests that altered HIP14-HTT and HIP14L-HTT interactions in the presence of the HD mutation reduces palmitoylation and promotes mislocalization of HTT and other HIP14/HIP14L substrates
24651384 Data show that deletion of huntingtin protein (HTT) amino acids 1-427 abolishes the interaction of HTT with palmitoyl acyltransferases huntingtin interacting protein 14 (HIP14) and huntingtin interacting protein 14-like (HIP14L).
18794299 huntingtin interacting protein genes, HIP14 and HIP14L, encode Mg2+ transport proteins that are regulated by their innate palmitoyl acyltransferases thus fulfilling the characteristics of "chanzymes."

AA Sequence

MEGPGLGSQCRNHSHGPHPPGFGRYGICAHENKELANAREALPLIEDSSNCDIVKATQYGIFERCKELVE      1 - 70
AGYDVRQPDKENVSLLHWAAINNRLDLVKFYISKGAVVDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGA     71 - 140
DPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPTGFLLKFNPSLN    141 - 210
VVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQK    211 - 280
FRLWRWLQKCELFLLLMLSVITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTA    281 - 350
FLLSSVFWIFMTWFILFFPDLAGAPFYFSFIFSIVAFLYFFYKTWATDPGFTKASEEEKKVNIITLAETG    351 - 420
SLDFRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSMVCGWIIYGSF    421 - 490
IYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLLNQLFQIAFLGLTSHERISLQK    491 - 560
QSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCVVDWTSQYTMVFHPAREKVLRSV            561 - 622
//

Text Mined References (14)

PMID Year Title
26198635 2015 Identification of a Novel Sequence Motif Recognized by the Ankyrin Repeat Domain of zDHHC17/13 S-Acyltransferases.
25849918 2015 Aberrant palmitoylation in Huntington disease.
24651384 2014 Identification of binding sites in Huntingtin for the Huntingtin Interacting Proteins HIP14 and HIP14L.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19946888 2010 Defining the membrane proteome of NK cells.
18794299 2008 Huntingtin-interacting proteins, HIP14 and HIP14L, mediate dual functions, palmitoyl acyltransferase and Mg2+ transport.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...