Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.35
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.106 7.6e-05
adult high grade glioma 1.300 2.9e-03
astrocytic glioma -1.600 4.3e-02
ductal carcinoma in situ 1.300 7.1e-03
intraductal papillary-mucinous adenoma (... 1.300 2.4e-03
intraductal papillary-mucinous carcinoma... 1.500 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 6.1e-03
invasive ductal carcinoma 1.300 3.6e-03
lung adenocarcinoma 1.347 3.7e-07
lung cancer 1.700 4.4e-03
lung carcinoma 1.400 3.1e-15
medulloblastoma, large-cell 1.300 3.2e-04
osteosarcoma -2.037 1.4e-04
ovarian cancer 1.300 2.1e-05
psoriasis -1.300 9.8e-04

Gene RIF (3)

AA Sequence

MEGPGLGSQCRNHSHGPHPPGFGRYGICAHENKELANAREALPLIEDSSNCDIVKATQYGIFERCKELVE      1 - 70
AGYDVRQPDKENVSLLHWAAINNRLDLVKFYISKGAVVDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGA     71 - 140
DPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPTGFLLKFNPSLN    141 - 210
VVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQK    211 - 280
FRLWRWLQKCELFLLLMLSVITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTA    281 - 350
FLLSSVFWIFMTWFILFFPDLAGAPFYFSFIFSIVAFLYFFYKTWATDPGFTKASEEEKKVNIITLAETG    351 - 420
SLDFRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSMVCGWIIYGSF    421 - 490
IYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLLNQLFQIAFLGLTSHERISLQK    491 - 560
QSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCVVDWTSQYTMVFHPAREKVLRSV            561 - 622
//

Text Mined References (14)

PMID Year Title