Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.78
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.1e-05
diabetes mellitus 1728 1.2e-03
Atopic dermatitis 952 1.4e-02

Gene RIF (1)

AA Sequence

MTCCQTSFCGYPSCSTSGTCGSSCCQPSCCETSCCQPSCCETSCCQPSCCQTSFCGFPSFSTSGTCSSSC      1 - 70
CQPSCCETSCCQPSCCQTSSCGTGCGIGGGIGYGQEGSSGAVSTRIRWCRPDCRVEGTCLPPCCVVSCTP     71 - 140
PTCCQLHHAEASCCRPSYCGQSCCRPVCCCYSCEPTC                                     141 - 177
//

Text Mined References (4)

PMID Year Title