Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.55
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 3.114 1.6

Gene RIF (2)

AA Sequence

MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMY      1 - 70
KHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEA     71 - 140
SVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE                             141 - 185
//

Text Mined References (8)

PMID Year Title