Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.27
PubTator Score 17.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 5.7e-09
atypical teratoid / rhabdoid tumor 1.400 9.5e-05
cystic fibrosis 1.163 3.3e-04
ependymoma 1.200 3.4e-09
glioblastoma 1.100 6.3e-03
juvenile dermatomyositis 1.181 3.4e-13
ovarian cancer -1.600 2.2e-07
subependymal giant cell astrocytoma 2.550 4.6e-03
tuberculosis 1.300 1.8e-06
ulcerative colitis -1.400 1.4e-07

Protein-protein Interaction (8)

Gene RIF (10)

AA Sequence

MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQP      1 - 70
HLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTE     71 - 140
LVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEK    141 - 210
LQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRT    211 - 280
VTVSHRPQPYRWSCERFSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVE    281 - 350
WKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLH    351 - 420
PGNYLIIKQVKV                                                              421 - 432
//

Text Mined References (23)

PMID Year Title