Property Summary

NCBI Gene PubMed Count 35
PubMed Score 77.82
PubTator Score 17.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.000
osteosarcoma 3.331 0.000
cystic fibrosis 1.635 0.000
group 4 medulloblastoma 1.500 0.005
medulloblastoma, large-cell 1.100 0.000
adult high grade glioma -1.100 0.023
Pick disease 1.100 0.007

Synonym

Accession Q8IUD2 A2RU77 A7E295 D3DUP7 D3DUP8 Q6NVK2 Q8IUD3 Q8IUD4 Q8IUD5 Q8NAS1 Q9NXN5 Q9UIK7 Q9UPS1 ERC-1
Symbols ELKS
Cast2
ERC-1
RAB6IP2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (9)

PMID Text
24982445 Liprin-alpha1, ERC1a and LL5 also define new highly polarized and dynamic cytoplasmic structures uniquely localized near the protruding cell edge
23583364 a new, but rare, antigen in Lambert-Eaton myasthenic syndrome
20932476 ATM- and NEMO-dependent ubiquitination of ELKS leads to the ubiquitin-dependent assembly of TAK1/TAB2/3 and NEMO/IKK complexes, resulting in IKK and NF-kappaB activation following genotoxic stimuli.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17690697 ERC1-PDGFRB fusion is associated with acute myeloid leukemia
15218148 ELKS likely functions by recruiting IkappaBalpha to the IkappaB kinase (IKK) complex and thus serves a regulatory function for IKK activation
12923177 In vitro results indicate that ERC2/CAST, an active zone-specific isoform, interacts with all of the known isoforms of liprin-alpha and that liprin-alpha1 associates with both ERC2 and ERC1b
12203787 Analysis of the gene structure of four isoforms (ELKS beta, ELKS gamma, ELKS delta, and ELKS epsilon) in a case of papillary thyroid carcinoma reveal that the isoforms are produced by alternative splicing.

AA Sequence

MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGSSVGGGSGKTLSMENIQSLNAAYATSG      1 - 70
PMYLSDHENVGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVP     71 - 140
HSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITI    141 - 210
WKEQYRVVQEENQHMQMTIQALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKE    211 - 280
LFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLL    281 - 350
EQKEKENSMLREEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTEERE    351 - 420
EEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLE    421 - 490
TLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIH    491 - 560
DLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIE    561 - 630
RLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLE    631 - 700
IALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVEN    701 - 770
EKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIE    771 - 840
ELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLT    841 - 910
NLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQTQNRM    911 - 980
KLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPAS    981 - 1050
YNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS       1051 - 1116
//

Text Mined References (42)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24982445 2014 Liprin-?1, ERC1 and LL5 define polarized and dynamic structures that are implicated in cell migration.
24613754 2014 A 1.5Mb terminal deletion of 12p associated with autism spectrum disorder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24152084 2014 Rab6 dependent post-Golgi trafficking of HSV1 envelope proteins to sites of virus envelopment.
23583364 2013 Antibodies to active zone protein ERC1 in Lambert-Eaton myasthenic syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22713806 2013 12p13.33 microdeletion including ELKS/ERC1, a new locus associated with childhood apraxia of speech.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22107844 2012 ELKS1 and Ca(2+) channel subunit ?4 interact and colocalize at cerebellar synapses.
More...