Property Summary

NCBI Gene PubMed Count 35
Grant Count 12
R01 Count 10
Funding $1,489,510.68
PubMed Score 77.82
PubTator Score 17.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.000
osteosarcoma 3.331 0.000
cystic fibrosis 1.635 0.000
group 4 medulloblastoma 1.500 0.005
medulloblastoma, large-cell 1.100 0.000
adult high grade glioma -1.100 0.023
Pick disease 1.100 0.007

Gene RIF (9)

PMID Text
24982445 Liprin-alpha1, ERC1a and LL5 also define new highly polarized and dynamic cytoplasmic structures uniquely localized near the protruding cell edge
23583364 a new, but rare, antigen in Lambert-Eaton myasthenic syndrome
20932476 ATM- and NEMO-dependent ubiquitination of ELKS leads to the ubiquitin-dependent assembly of TAK1/TAB2/3 and NEMO/IKK complexes, resulting in IKK and NF-kappaB activation following genotoxic stimuli.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17690697 ERC1-PDGFRB fusion is associated with acute myeloid leukemia
15218148 ELKS likely functions by recruiting IkappaBalpha to the IkappaB kinase (IKK) complex and thus serves a regulatory function for IKK activation
12923177 In vitro results indicate that ERC2/CAST, an active zone-specific isoform, interacts with all of the known isoforms of liprin-alpha and that liprin-alpha1 associates with both ERC2 and ERC1b
12203787 Analysis of the gene structure of four isoforms (ELKS beta, ELKS gamma, ELKS delta, and ELKS epsilon) in a case of papillary thyroid carcinoma reveal that the isoforms are produced by alternative splicing.

AA Sequence

MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGSSVGGGSGKTLSMENIQSLNAAYATSG      1 - 70
PMYLSDHENVGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVP     71 - 140
HSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITI    141 - 210
WKEQYRVVQEENQHMQMTIQALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKE    211 - 280
LFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLL    281 - 350
EQKEKENSMLREEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTEERE    351 - 420
EEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLE    421 - 490
TLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIH    491 - 560
DLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIE    561 - 630
RLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLE    631 - 700
IALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVEN    701 - 770
EKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIE    771 - 840
ELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLT    841 - 910
NLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQTQNRM    911 - 980
KLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPAS    981 - 1050
YNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS       1051 - 1116
//

Text Mined References (42)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24982445 2014 Liprin-?1, ERC1 and LL5 define polarized and dynamic structures that are implicated in cell migration.
24613754 2014 A 1.5Mb terminal deletion of 12p associated with autism spectrum disorder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24152084 2014 Rab6 dependent post-Golgi trafficking of HSV1 envelope proteins to sites of virus envelopment.
23583364 2013 Antibodies to active zone protein ERC1 in Lambert-Eaton myasthenic syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22713806 2013 12p13.33 microdeletion including ELKS/ERC1, a new locus associated with childhood apraxia of speech.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22107844 2012 ELKS1 and Ca(2+) channel subunit ?4 interact and colocalize at cerebellar synapses.
More...