Property Summary

NCBI Gene PubMed Count 24
PubMed Score 3.67
PubTator Score 4.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.300 2.1e-02
Astrocytoma, Pilocytic 1.500 7.6e-04
atypical teratoid / rhabdoid tumor -1.900 2.7e-03
ependymoma -1.800 2.8e-06
facioscapulohumeral dystrophy 1.900 4.9e-02
group 3 medulloblastoma -1.100 9.3e-03
lung adenocarcinoma -1.700 5.1e-11
lung carcinoma 4.400 9.1e-37
medulloblastoma, large-cell 1.100 2.0e-03
non-small cell lung carcinoma -1.100 6.1e-12
oligodendroglioma 2.200 1.6e-02
primitive neuroectodermal tumor -1.700 5.1e-03

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDD      1 - 70
QEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVIN     71 - 140
RSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAH    141 - 210
CECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGD    211 - 280
RTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATP    281 - 350
YTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD    351 - 420
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGP    421 - 490
VIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT        491 - 556
//

Text Mined References (25)

PMID Year Title