Property Summary

NCBI Gene PubMed Count 21
PubMed Score 3.46
PubTator Score 4.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 9.05415512827296E-37
lung adenocarcinoma 2714 2.25727699621181E-17
non-small cell lung carcinoma 413 6.09527382473303E-12
posterior fossa group A ependymoma 1511 3.1214706847418E-8
group 3 medulloblastoma 2254 1.31731036839942E-4
medulloblastoma, large-cell 6234 0.00200544434913218
atypical teratoid / rhabdoid tumor 4369 0.00265952352135467
primitive neuroectodermal tumor 3031 0.00514743265588403
pilocytic astrocytoma 3086 0.00530459238583285
astrocytic glioma 2241 0.0128205025221549
oligodendroglioma 2849 0.0163593535319976
facioscapulohumeral dystrophy 286 0.0488751412591061
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q8IUC8 Q08ER7 Q68VI8 Q6ZWG1 Q96PX0 Q9UIE5
Symbols GalNAc-T13

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid
Fruitfly OMA Inparanoid

 MGI Term (1)

Gene RIF (6)

PMID Text
26589799 Data suggest microRNA-424 regulates expression of MGAT4A (mannoside beta-1,4-N-acetylglucosaminyltransferase A), OGT (O-linked N-acetylglucosamine transferase), and GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13) in mammary epithelium.
24038392 we integrated different computational tools to perform the in silico analysis of clinically significant mutations (nsSNPs/single amino acid change) at both functional and structural levels, found in human GALNT3, GALNT8, GALNT12, and GALNT13 genes.
22679008 GALNT13 encodes a glycosyltransferase enzyme responsible for the synthesis of O-glycan.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
12407114 cloning and characterization of pp-GalNAc-T13; expressed in all neuroblastoma cells examined and primary cultured neurons but not in glioblastoma cells and primary cultured astrocytes

AA Sequence

MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDD      1 - 70
QEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVIN     71 - 140
RSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAH    141 - 210
CECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGD    211 - 280
RTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATP    281 - 350
YTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD    351 - 420
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGP    421 - 490
VIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT        491 - 556
//

Text Mined References (22)

PMID Year Title
26589799 2016 MicroRNA-424 Predicts a Role for ?-1,4 Branched Glycosylation in Cell Cycle Progression.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24348519 2013 EMR-linked GWAS study: investigation of variation landscape of loci for body mass index in children.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24038392 2014 Clinically significant missense variants in human GALNT3, GALNT8, GALNT12, and GALNT13 genes: intriguing in silico findings.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22679008 2012 A novel molecular signature for elevated tricuspid regurgitation velocity in sickle cell disease.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...