Property Summary

NCBI Gene PubMed Count 98
Grant Count 10
R01 Count 4
Funding $959,558.1
PubMed Score 31.81
PubTator Score 135.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.200 0.002

 GWAS Trait (1)

Gene RIF (73)

PMID Text
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26195481 In mice with nonfunctional TRIF (Trif(mut) mice), Ang II-induced hypertension and cardiac hypertrophy were abrogated, and proinflammatory gene expression in heart and kidneys was unchanged or decreased. These results indicate that Ang II induces activation of a proinflammatory innate immune response, causing hypertension and cardiac hypertrophy, which require functional adaptor protein TRIF-mediated pathways.
26100679 signaling through TRIF is important for the inflammatory response of AngII-induced abdominal aortic aneurysm formation
26056004 TRIF promotes angiotensin II-induced cross-talk between fibroblasts and macrophages in atrial fibrosis.
25754842 Data show that toll-like receptor 3/TRIF protein signalling regulates cytokines IL-32 and IFN-beta secretion by activation of receptor-interacting protein-1 (RIP-1) and tumour necrosis factor receptor-associated factor 6 (TRAF6) in cornea epithelial cells.
25736436 WDFY1 mediates TLR3/TLR4 signaling by recruiting TRIF.
25636800 findings show that TRIF activates IRF3 through a phosphorylation-dependent mechanism; results reveal that phosphorylation of innate adaptor proteins is an essential and conserved mechanism that selectively recruits IRF3 to activate the type I IFN pathway
25377948 involved in signaling that moderates the expression of heme oxygenase1 and il-8 after keratinocytes exposure to dinitrochlorobenzene
25049357 PTX3 binds MD-2 and promotes TRIF-dependent immune protection in aspergillosis.
24693944 MUC1 has a role in regulating epithelial inflammation and apoptosis by PolyI:C through inhibition of TRIF recruitment to Toll-like receptor 3
More...

AA Sequence

MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVA      1 - 70
RLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEA     71 - 140
RNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEIS    141 - 210
QSPTMPFLSLHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAP    211 - 280
DATSTGLPDTPAAPETSTNYPVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCP    281 - 350
PTPTTPETSPPPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG    351 - 420
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQGSPDCVIPFL    421 - 490
PLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGER    491 - 560
MQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQP    561 - 630
PPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRG    631 - 700
SQAPEDKTQEAE                                                              701 - 712
//

Text Mined References (103)

PMID Year Title
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26195481 2015 Dual Activation of TRIF and MyD88 Adaptor Proteins by Angiotensin II Evokes Opposing Effects on Pressure, Cardiac Hypertrophy, and Inflammatory Gene Expression.
26100679 2015 TRIF adaptor signaling is important in abdominal aortic aneurysm formation.
26056004 2015 TRIF promotes angiotensin II-induced cross-talk between fibroblasts and macrophages in atrial fibrosis.
25754842 2015 TLR3/TRIF signalling pathway regulates IL-32 and IFN-? secretion through activation of RIP-1 and TRAF in the human cornea.
25736436 2015 WDFY1 mediates TLR3/4 signaling by recruiting TRIF.
25636800 2015 Phosphorylation of innate immune adaptor proteins MAVS, STING, and TRIF induces IRF3 activation.
25377948 2016 The involvement of the Toll-like receptor signaling and Nrf2-Keap1 pathways in the in vitro regulation of IL-8 and HMOX1 for skin sensitization.
25049357 2014 PTX3 binds MD-2 and promotes TRIF-dependent immune protection in aspergillosis.
24693944 2014 MUC1 regulates epithelial inflammation and apoptosis by PolyI:C through inhibition of Toll/IL-1 receptor-domain-containing adapter-inducing IFN-? (TRIF) recruitment to Toll-like receptor 3.
More...