Property Summary

NCBI Gene PubMed Count 22
Grant Count 6
R01 Count 4
Funding $366,222.59
PubMed Score 10.38
PubTator Score 7.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26349980 We found significant association between RHPN2 gene rs10411210 and colorectal cancer in European and Asian populations, but not American population
25799222 Single nucleotide polymorphism in RHPN2 gene is associated with colorectal cancer.
23774217 These effects were implemented through RHPN2-mediated activation of RhoA.
21071539 Observational study of gene-disease association. (HuGE Navigator)
20659471 Observational study of gene-disease association. (HuGE Navigator)
20648012 Observational study of gene-disease association. (HuGE Navigator)
20638935 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20530476 Observational study of gene-disease association. (HuGE Navigator)
20501757 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
More...

AA Sequence

MTDALLPAAPQPLEKENDGYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLKVATNSKVR      1 - 70
EQVRLELSFVNSDLQMLKEELEGLNISVGVYQNTEEAFTIPLIPLGLKETKDVDFAVVLKDFILEHYSED     71 - 140
GYLYEDEIADLMDLRQACRTPSRDEAGVELLMTYFIQLGFVESRFFPPTRQMGLLFTWYDSLTGVPVSQQ    141 - 210
NLLLEKASVLFNTGALYTQIGTRCDRQTQAGLESAIDAFQRAAGVLNYLKDTFTHTPSYDMSPAMLSVLV    211 - 280
KMMLAQAQESVFEKISLPGIRNEFFMLVKVAQEAAKVGEVYQQLHAAMSQAPVKENIPYSWASLACVKAH    281 - 350
HYAALAHYFTAILLIDHQVKPGTDLDHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHH    351 - 420
EESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNLIDAPSVVAKTEQEVDIILPQFSKL    421 - 490
TVTDFFQKLGPLSVFSANKRWTPPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVS    491 - 560
IQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLDSTSSMHNKSATYSVGMQKTYSMICLAIDDDDKTDK    561 - 630
TKKISKKLSFLSWGTNKNRQKSASTLCLPSVGAARPQVKKKLPSPFSLLNSDSSWY                  631 - 686
//

Text Mined References (25)

PMID Year Title
26349980 2015 Analyzing large-scale samples highlights significant association between rs10411210 polymorphism and colorectal cancer.
25799222 2015 Association between GWAS-identified genetic variations and disease prognosis for patients with colorectal cancer.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23774217 2013 RHPN2 drives mesenchymal transformation in malignant glioma by triggering RhoA activation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21071539 2011 Generalizability and epidemiologic characterization of eleven colorectal cancer GWAS hits in multiple populations.
20659471 2010 Genetic heterogeneity in colorectal cancer associations between African and European americans.
20648012 2010 Association studies on 11 published colorectal cancer risk loci.
More...