Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.1e-03

Synonym

Accession Q8IUC3 Q3LI56
Symbols KAP7.1

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MTRYFCCGSYFPGYPIYGTNFHGTFRATPLNCVVPLGSPLNYGCGCNGYSSLGYSFGGSNINNLGGCYGG      1 - 70
SFYRPWGSGSGFGYSTY                                                          71 - 87
//

Text Mined References (3)

PMID Year Title