Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 0.00113045250835818

Synonym

Accession Q8IUC3 Q3LI56
Symbols KAP7.1

Gene

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MTRYFCCGSYFPGYPIYGTNFHGTFRATPLNCVVPLGSPLNYGCGCNGYSSLGYSFGGSNINNLGGCYGG      1 - 70
SFYRPWGSGSGFGYSTY                                                          71 - 87
//

Text Mined References (3)

PMID Year Title
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
12359730 2002 Characterization of a first domain of human high glycine-tyrosine and high sulfur keratin-associated protein (KAP) genes on chromosome 21q22.1.
10830953 2000 The DNA sequence of human chromosome 21.